(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_13.PE334

PENCW_13.PE334       Location/Qualifiers
FT   CDS_pept        join(755459..755505,755557..755758,755818..755895)
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15947695"
FT                   /orf_name="Pc16g03340"
FT                   /product="Pc16g03340 protein"
FT                   /biological_process="cell wall macromolecule catabolic
FT                   process"
FT                   /protein_id="CAP93004.1"
FT                   /db_xref="GO:0016998"
FT                   /db_xref="InterPro:IPR018392"
FT                   /db_xref="UniParc:UPI0001831E9E"
FT                   /db_xref="UniProtKB/TrEMBL:B6H934"
FT                   /transl_table=1
FT                   /translation="MGALTWRMGITSHLTISVWNPAVGEGCGSLKIEYYVCVGVSGDMI
FT                   PSTTAKKTTTTSDGGRVTVVPGDGCYDVAADHGISLTNFYSWNPSVRDDCSELKFDSYA
FT                   CVGI"
     atgggtgctt tgacctggcg aatgggtata acatcacact taacgatttc tgtatggaac        60
     cccgccgtcg gggagggttg cggatctctc aaaatagaat attacgtctg tgttggggtt       120
     tctggtgata tgataccatc tacaactgcc aaaaagacta cgactactag tgacggcggt       180
     agagtcacgg tcgtccctgg tgatggatgc tatgatgtag ccgcggatca tggtatttcc       240
     ctaactaatt tctacagctg gaatcctagt gtcagggatg attgcagtga gctcaagttc       300
     gattcttatg cctgtgtggg gatctag                                           327
//

If you have problems or comments...

PBIL Back to PBIL home page