(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_13.PE335

PENCW_13.PE335       Location/Qualifiers
FT   CDS_pept        join(756722..756849,756930..757082,757142..757603,
FT                   757695..758634)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000178476" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20671659"
FT                   /orf_name="Pc16g03350"
FT                   /product="Pc16g03350 protein"
FT                   /biological_process="transmembrane transport"
FT                   /protein_id="CAP93005.1"
FT                   /db_xref="GO:0055085"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR016196"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="UniParc:UPI0001831E9F"
FT                   /db_xref="UniProtKB/TrEMBL:B6H935"
FT                   /transl_table=1
FT                   /translation="MADQDEIRGNSVYEPEQPVTETSSPVEKPVAPKEQKKSGLMAKIG
FT                   RMLNQDVSEEMPAYKDIQIHTWDGPDDPENPFNWSLKYKWLLTITVCFISILTGLPAGT
FT                   YGSGNDWMGKEFNVQNEPFPNLYWATTSWNMGAAFWPLIFVPLTEASGRMPGYFVAYVI
FT                   LVISLFPSAFAKNFATLVVTRFFGGGASSVSINIVGGSISDVWLGDHARSLPMSIFGFT
FT                   SVVGIALGPFIGSAIVQIQKSEPWRWIFYVQIIYNAALIPVFWLILNETRPDVILKKRA
FT                   RKIRKETNLPVYAAAEIDAPSKLRLLKISFQRPTSMLLTEPVVTFFTLWISFAWGILYL
FT                   FFSSVVQTYSTNYGWGTLSTGLVQLAISVGAIIGTMINPLQDWYYLRSSRRNKEKPGKP
FT                   IPEARLYTSIPGSLLFAAGLFWYGWASQPDIHWIVPTIGITAAGIGIYSIYMAVVNYLT
FT                   DAYERYAASALSAASLGRNAFGAFLPLASPQLFSNLGFGWAGTLLGFIGIALSVVPVIL
FT                   VWKGPQIRERSKFMREAMWEPEEKVEVDRSGKEDLGPSAEGVA"
     atggcggacc aagacgagat ccgtggcaat tcagtctatg agcctgaaca gcctgtcact        60
     gaaacgtcct cgccggttga gaagcctgtt gctccgaagg aacagaagaa atccggcttg       120
     atggctaaaa tcgggagaat gctgaaccaa gatgtcagcg aggaaatgcc tgcatacaag       180
     gatatccaaa tccacacctg ggacgggccc gacgaccccg agaatccctt caactggagc       240
     ctcaaataca aatggctgct cacgatcacc gtatgcttca tctctatcct gaccggtctc       300
     cccgcaggaa cctacggttc cggcaacgac tggatgggga aagaattcaa cgtccagaac       360
     gagcccttcc cgaacctgta ctgggccacc acgtcctgga atatgggcgc tgcgttctgg       420
     cccctgatct tcgtccctct gaccgaggcc tccggccgta tgccaggata cttcgtggca       480
     tatgtgatcc tcgtcatttc gctcttcccg tccgcgttcg caaagaactt cgcaacactc       540
     gtcgtgactc ggttcttcgg cggtggtgct tcttccgtct cgattaatat cgtcggtgga       600
     agtatctccg atgtgtggct cggtgatcac gctcgcagtc ttccgatgtc tatcttcggc       660
     ttcacgagtg ttgtgggtat tgcacttggt ccatttatcg ggtctgcaat tgtccagatt       720
     cagaaatcgg agccgtggcg ttggatcttc tacgtccaaa tcatctacaa cgcagcccta       780
     atcccagtct tctggctaat cctcaacgaa acccgcccag acgtgatcct caagaagcgc       840
     gcacgcaaga tccgcaaaga aaccaacctc cccgtctacg ccgccgccga aatagacgcc       900
     ccgagcaaac tccgtctcct aaaaatctcc ttccaacggc caacaagcat gctcctaacc       960
     gagccggtcg taaccttctt caccttatgg ataagtttcg cctggggaat cctctacctc      1020
     ttcttctcca gcgtggtaca aacctactca acaaactacg gctggggcac gctgtccaca      1080
     ggcctggtgc agctcgccat ctcggtaggc gcgatcatcg ggacaatgat caacccacta      1140
     caagactggt actatctccg ctcttcgcga cgcaacaaag agaaacccgg taaacctatt      1200
     cccgaggcca gactgtacac ttccatcccg ggtagcctgc tgtttgcggc gggtttgttc      1260
     tggtatggat gggccagtca gccggatatt cattggattg tgccgactat tgggattacg      1320
     gctgcgggaa ttgggattta ttcgatttat atggctgttg ttaattacct gactgatgct      1380
     tatgagcggt atgcggcgtc ggctttgtcg gctgcttcgc ttgggaggaa tgcttttggg      1440
     gcgtttttgc cgcttgcttc gccgcagttg ttttcgaatc ttgggtttgg atgggctggg      1500
     actttgcttg ggtttattgg aattgcgttg tcggttgttc ctgttatttt ggtttggaag      1560
     ggcccgcaga ttcgggagag gagtaagttt atgagagagg ctatgtggga gcctgaggag      1620
     aaggttgagg ttgatcggtc tggaaaggag gacttggggc cttctgctga gggagttgca      1680
     tga                                                                    1683
//

If you have problems or comments...

PBIL Back to PBIL home page