(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_13.PE336

PENCW_13.PE336       Location/Qualifiers
FT   CDS_pept        join(complement(760170..760291),complement(759964..759993),
FT                   complement(759809..759895),complement(759033..759747))
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000168307" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15947696"
FT                   /orf_name="Pc16g03360"
FT                   /product="Pc16g03360 protein"
FT                   /function="binding"
FT                   /biological_process="transmembrane transport"
FT                   /cellular_component="integral to membrane"
FT                   /cellular_component="mitochondrial inner membrane "
FT                   /protein_id="CAP93006.1"
FT                   /db_xref="GO:0005488"
FT                   /db_xref="GO:0005743"
FT                   /db_xref="GO:0016021"
FT                   /db_xref="GO:0055085"
FT                   /db_xref="InterPro:IPR001993"
FT                   /db_xref="InterPro:IPR002067"
FT                   /db_xref="InterPro:IPR018108"
FT                   /db_xref="UniParc:UPI0001831EA0"
FT                   /db_xref="UniProtKB/TrEMBL:B6H936"
FT                   /transl_table=1
FT                   /translation="MSETAQKPLPFVYQFAAGAVAGVSEVCVSCFRFEKRFRLDSYPLD
FT                   VLKTRIQLQTGAPVPGVDHYNGMFDCFRKIVKNEGASRLYRGISAPILMEAPKRATKFA
FT                   ANDSWGAFYRNLFGVDKQTQSLATLTGATAGATEAFVVVPFELVKIRLQDKAQAHKYNG
FT                   MFDVVKKIVAAEGPLAMYNGLESTMWRHVLWNAGYFGCIFQVRAQLPAVEPGNKNQQMR
FT                   NDLIAGSIGGTTGTILNTPMDVVKSRIQNTTKVPGQVAKYNWAWPALGTVMKEEGFSAL
FT                   YKGFTPKVLRLGPGGGILLVVYTGVMDFFRKMRDGN"
     atgtccgaaa ctgcccagaa gccgctcccc ttcgtctacc agttcgccgc cggtgcggtg        60
     gctggtgtct cagaggtatg tgtctcttgc tttcgttttg agaagcgatt ccgacttgat       120
     tcgtaccctc tggacgtcct caagacccga atccagcttc agaccggagc ccctgttccc       180
     ggtgttgatc actacaatgg catgttcgac tgcttccgca agattgttaa gaacgagggt       240
     gcctcccgtc tataccgtgg tatctccgca cccatcctga tggaggcacc gaagcgtgcg       300
     accaagttcg ccgccaacga cagctgggga gctttctacc gcaacctgtt cggtgtggac       360
     aagcagactc aaagcctggc cactttgact ggagccacag ccggtgcgac tgaagccttc       420
     gtggtggttc cgttcgagct ggtgaagatt cgtctgcagg ataaggccca ggcccacaag       480
     tacaacggca tgttcgacgt ggtgaagaag atcgtggccg cagagggccc gctcgcaatg       540
     tacaacggcc ttgagtcgac catgtggcgt cacgtactgt ggaacgctgg ttacttcggc       600
     tgtatcttcc aggtccgcgc acagctgcct gccgtggagc ccggcaacaa gaaccagcaa       660
     atgcgcaacg acctgatcgc cggttctatc ggtggtacca ccggtactat cctcaacacc       720
     cccatggacg ttgtcaagtc ccgcatccag aacaccacca aggttcctgg tcaggtcgcc       780
     aagtacaact gggcctggcc tgccctcggc accgtgatga aggaggaggg cttctctgcc       840
     ctgtacaagg gcttcacacc taaggttctg cgtctcggtc ctggcggtgg tatcctgctt       900
     gttgtttaca ctggtgtcat ggatttcttc cgcaagatgc gcgatggaaa ctaa             954
//

If you have problems or comments...

PBIL Back to PBIL home page