(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_13.PE337

PENCW_13.PE337       Location/Qualifiers
FT   CDS_pept        join(complement(761381..762050),complement(760674..761293))
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000208295" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19824339"
FT                   /orf_name="Pc16g03370"
FT                   /product="Pc16g03370 protein"
FT                   /protein_id="CAP93007.1"
FT                   /db_xref="UniParc:UPI0001831EA1"
FT                   /db_xref="UniProtKB/TrEMBL:B6H937"
FT                   /transl_table=1
FT                   /translation="MQILHALTVFCSLPQFATLISAEKINPSGDQESKEAETPLPASLI
FT                   LRRNAAIASQLAAGPALGVKKMSDDEGEKFFLDYWSFGNDSSSGNITEGHVSDDGFSPA
FT                   RFVAQSYPFAPSYSLGTDGDSQFLPWENSHSANNLLEKRDFKCPAGTWACTSIGRSDRC
FT                   CGSGETCEIVADTGHGDVGCCPSWKTCSGMIGSCQSGYTACSQALGGGCCIPGYDCVEG
FT                   GCAYITTITVTLHSTVMLSTVTYSTKPQDTTSTSASFSFPTTSSHSSKTTTNDGLAPPA
FT                   RPTNLSTVTSATRGDDVCPTGFYACSAVYHGGCCRTGRDCDTTSCPTISSTTVVSDGVT
FT                   IVAPAATTTEHTSGNRCAHGWFHCADTVGGGCCPMGFACGSSCTARDTAFATTVAKEQA
FT                   TASSGGSVVHRVSKMMLGMMIGMSVGVWIL"
     atgcagatcc tccatgccct caccgtgttc tgctcactac cacagtttgc aaccctgatt        60
     tcagcagaaa agataaatcc ttcaggtgat caagagtcca aagaggctga gacaccacta       120
     ccagcaagcc ttatcctacg gcgcaatgcc gctatagcat cccaactcgc agcaggacca       180
     gccctcggcg tgaagaaaat gagcgacgac gaaggcgaga aattcttcct tgactactgg       240
     agtttcggga atgactcttc gtcaggtaac ataactgagg gacacgtctc cgacgacgga       300
     ttttccccag cgcgctttgt ggcccaatca tacccattcg cgccatctta ctccttgggc       360
     acagatgggg acagtcaatt ccttccctgg gaaaacagtc acagtgcaaa caatctgctc       420
     gagaaacgag acttcaagtg tccagctggg acatgggcgt gcacatccat cggtcgatcc       480
     gatcgctgct gtgggtccgg ggagacgtgc gagatcgtcg ctgatacggg gcacggcgat       540
     gtgggctgct gtcctagctg gaagacttgc tctgggatga ttgggtcgtg tcagagtggg       600
     tatacggctt gctcacaggc tctggggggt ggatgttgta ttccaggata tgactgtgtg       660
     gaagggggat gcgcatacat cacaactatt acggtgactc ttcattcgac cgtgatgttg       720
     tctactgtga cctactcgac caaaccgcag gatactactt ccacttctgc ttccttctct       780
     ttcccgacga cctcttctca tagcagcaag accacaacaa atgatggctt ggcaccacca       840
     gcacggccta caaacctgtc aacagtaacc agtgctaccc gcggcgacga tgtctgcccg       900
     actggtttct atgcttgctc tgccgtctac cacggtggct gctgccgcac cggacgagat       960
     tgcgatacga cttcatgccc gaccatatct tcgacaactg tcgtatcgga cggtgtgact      1020
     attgtagcgc ccgccgcgac gacgacggaa cacactagtg ggaaccggtg cgctcatggt      1080
     tggtttcact gtgctgacac cgtgggtgga ggatgttgtc ctatgggatt cgcctgtggt      1140
     tccagctgta ctgcaaggga caccgcgttt gcgacgaccg tcgccaagga acaagcgacc      1200
     gcgagtagcg gaggtagtgt tgtgcaccgc gttagcaaaa tgatgttggg aatgatgatt      1260
     ggaatgagtg tgggagtttg gatattatga                                       1290
//

If you have problems or comments...

PBIL Back to PBIL home page