(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_13.PE338

PENCW_13.PE338       Location/Qualifiers
FT   CDS_pept        join(complement(765945..766010),complement(764848..765850),
FT                   complement(762896..764691))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000208306" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19824340"
FT                   /orf_name="Pc16g03380"
FT                   /product="Pc16g03380 protein"
FT                   /protein_id="CAP93008.1"
FT                   /db_xref="InterPro:IPR005613"
FT                   /db_xref="InterPro:IPR022782"
FT                   /db_xref="UniParc:UPI0001831EA2"
FT                   /db_xref="UniProtKB/TrEMBL:B6H938"
FT                   /transl_table=1
FT                   /translation="MASQQSGRSSSASSRSQSSKSQIEKSVTHLLVATKQLLETLTQWS
FT                   RKQASENDVSDVYVRLGYEFNLACRAFSAIGVDTSDLGPVPDLLRTILEDTLSQDASSQ
FT                   SLDRYLPRIRDIIINLLKGLKKKQARLRSRHQREDGRPVPGRQASAGSIASGQAIGQLY
FT                   DEAAASTMPSTAQSTSQSPRRSNRRYGSGGSLEDQPAIARTSSAPSTSEPRANFTERET
FT                   SRREAQQMLSQPTPFDNDTTPRANAPNNTAPSTYITPTGFSAPPPPPPPKEDDALGALQ
FT                   RSGELERRASRRFSAYQIQKHLGTSTNGVPVLPTQNSPIPNRGRDVRESLNAVRLRGSF
FT                   AHTRQRSNNRLQEAAKMEATIVPPPIIPVPQEKPTLEDAFEPAKPTPQTPKGDSFGPSA
FT                   EVGTPLSAIQFATEQPSPGKELTLFLQYKSKIKKYVLPEGIAELTIGRLQLAFIEKFAW
FT                   NTHDNGVDLPEIYIQDPISGIRHELEDLADVKDRSVLVLNVDNLDEVKKHFDDSLGSVR
FT                   LLVEGVKETLSGQGNIIQRVSDRQLEAAKEIARLAASPPANSAPAAIGGNSKASIAGSG
FT                   SQIAELQSLRRDLAVLRQTYSNFTADITGSMSAVRAKASKVRTAADDVATPSYEGDAGR
FT                   ARVNTGKKELAAESERLVARVDDLQDLVEDLRKDVVTRGVRPLPRQLEGVSRDISMVMK
FT                   EIKKMQDFLGREKPIWTKIWEKELQLVCEERDQLTMQEDLAADLQDDLEKATQTFALVE
FT                   QATKEQVLTNATGGTAVRAPSRTLGIDPTIDPMKAKDGVLGEVRALQPNHESRLEAIER
FT                   AEKARKKELETRRIGLFQKELGAFVEEGKLKKSGGFEETERLRTAKDDRIRKEVWDRQQ
FT                   ARNAEMEKAEAEAAAAQAAEQNKEGEGDDDQQEGEKEVTREDGDEAEEAAEKAEEPKSP
FT                   SSDAAKPLPKSPEEDNGTSEQPSA"
     atggcttccc aacagtccgg ccgcagttcc tccgcctcgt ctcgatccca gtccagcaag        60
     agtcagatcg aaaagagcgt gacgcacctc ttggtcgcga caaaacaact cctcgaaacc       120
     ttaacgcaat ggtctcggaa gcaagcgtcg gagaatgatg tgtcggatgt atacgttcga       180
     ttgggctatg aattcaactt ggcttgtcgg gccttcagtg ccatcggagt cgacacctca       240
     gacctcggtc ccgtaccaga cctgctccgc acgatactcg aagacactct tagtcaggat       300
     gcatcttccc agagcctcga tagatacctt ccccgaatcc gagatataat catcaacttg       360
     ttaaaagggc tgaagaagaa gcaagctcgc ttaaggtccc ggcaccagcg cgaagatggc       420
     cggcccgtac caggacggca agccagtgca gggagcatcg ctagtgggca ggcgattggt       480
     cagttgtatg atgaggctgc agcatccacc atgccgtcga cagcccagtc cacgtcccag       540
     tcccccagaa gatcgaaccg acggtatggc agcggtggat cactggagga tcaacccgcc       600
     attgctcgaa cctcctcggc accttcgaca agcgaaccgc gcgcaaactt caccgaaaga       660
     gaaacatcgc ggcgagaggc ccagcaaatg ctgtctcaac ccaccccctt cgataatgat       720
     acaacccctc gagccaacgc acccaacaat actgcgcctt caacatatat cacacccaca       780
     gggttctctg cacctccgcc tccacctccg cctaaagaag atgacgcatt gggggctttg       840
     caaagaagtg gggagcttga gaggcgtgcc tcgcgtcgat tctctgctta tcaaattcaa       900
     aagcatttgg gcacatcgac caacggggtt cctgtcctgc ctactcagaa ctctcccatt       960
     cctaatcgtg gtcgtgatgt ccgcgaatcc ttaaacgcag ttcgtctgcg gggctcattt      1020
     gcccatacca gacaaagatc caacaaccgc ttacaggaag ccgccaagat ggaagctaca      1080
     atcgttcctc ctcccattat tcccgtgccc caagagaagc caacactcga agacgctttc      1140
     gaacccgcga aaccaacacc ccaaaccccg aagggggact ctttcggacc gtccgccgag      1200
     gtcggaacac ctctatcagc cattcaattt gctactgagc aaccctcacc aggcaaagaa      1260
     ctgacactgt ttctgcaata caaaagcaaa attaagaagt atgtgctccc agagggcatt      1320
     gcagagctca ccattgggcg cctgcagctc gcttttattg aaaagtttgc ctggaatacc      1380
     cacgataatg gcgttgattt gccggaaatc tatatccaag acccgatttc aggcatccga      1440
     catgaactag aagatcttgc cgatgtcaaa gatcggtccg tcctggtact taatgttgac      1500
     aacctcgatg aggtcaagaa acattttgat gatagcctcg gaagcgtgcg cctcctggtc      1560
     gaaggcgtca aagagacgct ttctggccaa ggaaatatca tccagcgggt ttcggatcgc      1620
     cagcttgaag ctgccaaaga aatcgctcgc ttagccgctt ctcccccagc aaactctgct      1680
     ccggctgcca ttggagggaa ctcaaaagca tcaattgccg gaagcggatc tcaaattgcg      1740
     gagcttcaga gcttgcgccg tgacttggct gtcctgcgac agacctactc caactttact      1800
     gcagacatca ccggttccat gagtgcagtc cgtgccaagg caagcaaggt ccggaccgcc      1860
     gccgatgacg ttgctactcc ctcttatgaa ggtgatgctg gccgtgctcg ggtgaacact      1920
     ggcaagaagg aactcgcagc cgaatctgag cgcctggtcg ctcgcgtcga tgatctccaa      1980
     gatttggttg aggatcttcg gaaggatgtt gtgactcgtg gtgttcgtcc tctcccaaga      2040
     caattggagg gtgtcagccg cgacattagc atggtcatga aagaaattaa gaaaatgcag      2100
     gacttcctgg gtcgcgagaa gcccatctgg actaagatct gggagaagga gctacagctg      2160
     gtttgcgaag aacgagacca gcttaccatg caggaggacc ttgctgccga cttgcaagac      2220
     gacctcgaga aggcaaccca gaccttcgcc ttggtggagc aagccacgaa ggagcaggtc      2280
     ttgacaaatg caactggtgg caccgcggtc cgcgccccat ccaggactct tggaatcgac      2340
     ccaaccattg atcccatgaa ggccaaggac ggtgtcctag gcgaggtccg tgctttgcaa      2400
     cccaaccatg aaagccgact cgaggccatt gagcgagccg agaaagcacg aaagaaggag      2460
     cttgagactc gtcggatcgg tcttttccag aaggaactcg gtgcatttgt cgaagaaggc      2520
     aagttgaaga agagcggtgg ttttgaagag actgagcgtc tccgtactgc gaaggatgac      2580
     cgcatccgca aagaagtttg ggatagacag caggcccgca atgccgagat ggagaaggca      2640
     gaggcggaag ccgctgctgc gcaggcggcg gagcaaaaca aggagggcga gggtgatgac      2700
     gaccagcaag aaggcgaaaa ggaggtgact cgggaggatg gagacgaggc agaggaggca      2760
     gcagagaagg cagaagagcc caagtcgcca tcttccgacg cggcaaagcc actccccaaa      2820
     tcgccggagg aagacaacgg tacctccgaa cagccctctg cctga                      2865
//

If you have problems or comments...

PBIL Back to PBIL home page