(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_13.PE339

PENCW_13.PE339       Location/Qualifiers
FT   CDS_pept        join(768867..769024,769293..769482,769536..769809,
FT                   769868..772201,772255..772460)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000208317" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15947697"
FT                   /orf_name="Pc16g03390"
FT                   /product="Pc16g03390 protein"
FT                   /protein_id="CAP93009.1"
FT                   /db_xref="InterPro:IPR009604"
FT                   /db_xref="UniParc:UPI0001831EA3"
FT                   /db_xref="UniProtKB/TrEMBL:B6H939"
FT                   /transl_table=1
FT                   /translation="MASALNSVAANNASGNASAGAPNPGRSTLRSSNSTKGSDNRRQSG
FT                   SPIDGGQRRTNSHKAWTQGTNPITQRSSYTSSNGNMTHQKQSGSSRLNQKESNTPDSHA
FT                   HDRLVFLFASFTGLHTTITTKSGEKFTGIFSSSTMEPNELSFLLKMVQRTSQEGQPRAN
FT                   GISDVATPYIGSAPEHIMSFDIKDVVDIAVPNVTTAEVSAKEPNGASQGFRTDSDISGN
FT                   LAMRERTLQRWEPAETDIDMSLETSNTSAGWDQFEANERLFGAKTNYDENIYTTRLDRS
FT                   DPNYKQKQAEAARIAREIEGQDVDNSHMREERGLVAPDTGDQDEEDKYSGVRREDKAFP
FT                   PLLSGQPNKYMPPGRRQAAPQSTATPSASTKQPVAPVPTAPIPIPSQAVAKETTPADQQ
FT                   TELVASLQPTTDTEQKSALGKGVTPPVSTASPAPAGKRTAPENATANVEVEVLDHFRQF
FT                   ANSEKIKMQERRRNQASYDRTMKLNELMKFSKSFKLSTPVPKDLVPILAKDRLKQEAIM
FT                   QRALQQGDDKATPKVTTPPTEQQPPTRGAGPSGAVPPSAPADRQNYNRTRQGYPPAGPL
FT                   AGAGGRFPQQVPPGRPGVGMLSHRLADNLQQRKGAGMGPVPTPLPIQDARGPPTGPASD
FT                   QQRITSPVKSQAGSSAATKFNVKAMEFKPNPAASTFTPGTSGTAASPRPFSRNRSVSRA
FT                   TTPTAFFGSRKPLPVSERPSISDQFNPIKRMKKEHAETAERLIMLNGGIPPPYKTLPTW
FT                   DIADGSEEKTYDEMFKQPVAVPTVPPQGRSVSNNTNIPQQHQVPFHFQQGNPAMPPSSG
FT                   PSNGPHGLHSQGPHGPSHVDDHHRMQLSASNSQVFPSPRMQHGYPSPMAPHAQLSFPQP
FT                   VPQFYGGPQPGHIRPFQGGGPQFVNGAPMMVQQASNGPYMGVPQGMSPYNAQMPMYSPN
FT                   PGHAYPQHTPQPHSGYPSPSRGAPMMMHQNSQSGQPPQSMMFMPGQPGYPQQSGHMPPN
FT                   RGNYPQQPHFSSSPHQSHHFPPNQHRTPSNGFNQMPQMPPQMPAATPATTPGASHPAEA
FT                   TDEGK"
     atggcttccg ctctcaactc tgtggcggcc aacaacgcgt ctggcaatgc cagcgcgggt        60
     gcccccaacc ccggtcgatc taccctgaga tccagtaaca gcacgaaggg gtccgacaac       120
     cgacgacagt cgggtagccc catcgatggc ggacaacggc gcacaaactc ccacaaggcc       180
     tggacccaag ggaccaaccc catcactcaa cgatcttcat acacttcatc gaacggcaac       240
     atgacccacc agaagcagtc tgggtcctcg agactcaacc agaaggagtc aaacacccct       300
     gatagccatg ctcacgaccg ccttgtcttc ctattcgcca gcttcacggg cctacatact       360
     accattacca ccaagtccgg agagaagttt accggtatct tctcttcctc gaccatggag       420
     cccaacgaac tttccttcct gctcaagatg gtccagcgaa cctcacaaga gggccagccc       480
     cgggcaaacg gcatcagcga tgtcgcaacc ccgtatatag gctccgcacc cgagcacatc       540
     atgtcgttcg atatcaagga tgtcgtcgac attgccgttc caaacgttac cacagctgaa       600
     gtttcagcca aggaaccaaa cggtgcttcc cagggtttca ggacagacag tgatatctcc       660
     ggaaacctag ccatgcgaga acgcaccttg cagcgctggg aaccggctga gactgacatt       720
     gatatgtcac tcgaaacgag caatacttct gcgggatggg atcagtttga ggcaaacgag       780
     cgtcttttcg gcgccaagac caactacgat gagaacatct acaccactcg cctggaccgt       840
     tcggatccca actacaaaca gaagcaggcg gaggcagctc ggatcgcccg tgagattgag       900
     ggacaagatg tggacaactc ccacatgcgc gaggagcgtg gccttgtagc acccgatacc       960
     ggtgaccaag acgaagaaga caagtacagt ggtgttcgcc gcgaagacaa agccttccct      1020
     cccctgcttt ccggccagcc aaacaagtac atgccccccg gacgccgaca ggcagcccca      1080
     cagtctactg cgactcccag tgcatccacc aaacagcctg ttgctccggt tcccaccgct      1140
     cctatcccca tcccctctca ggccgtggcg aaggaaacta caccagcaga ccagcaaact      1200
     gagctggtcg cctctctgca acccacaaca gataccgagc agaagagtgc cttaggcaag      1260
     ggtgtcacac cgccagtatc tactgcatcc cccgcaccag ctggaaagcg gactgcacct      1320
     gaaaatgcga ccgcaaacgt ggaggtggag gtgcttgatc acttccggca gttcgcaaat      1380
     agcgagaaaa tcaagatgca ggagcgccgt cgcaaccagg cctcgtatga ccggaccatg      1440
     aaactcaatg agctgatgaa gttttccaag agcttcaaac tctccactcc ggtgccgaaa      1500
     gatcttgttc ctatcctagc caaggaccga ctaaagcaag aagcaatcat gcaacgagcg      1560
     ctgcaacaag gggacgacaa ggctacgccg aaggtcacta cgcctcccac agagcaacaa      1620
     ccgcctactc gtggtgccgg acctagtgga gctgtgcccc catccgcacc cgctgatcgt      1680
     caaaactaca accgcactcg tcagggttat cctccagctg gtccgctcgc tggtgctggt      1740
     ggcagattcc ctcagcaagt tccaccggga cgtcctggtg ttggcatgct cagtcaccga      1800
     ctagcggaca atctgcagca acgaaagggc gcgggtatgg gacctgttcc cactcctctt      1860
     cccattcaag atgcccgtgg acccccgact ggtcctgcca gcgatcagca gagaatcacc      1920
     agccctgtca agtcgcaggc cgggtcttct gcggcaacca agtttaatgt taaagctatg      1980
     gagttcaagc caaaccccgc agcgagcact ttcacccctg gtacctcggg aactgccgca      2040
     agcccacggc ctttctctcg caaccgctcc gtgtcacgcg ccacaacccc gactgcgttc      2100
     tttggctcaa ggaagccact gcctgtctcc gaacgaccct cgatcagtga ccaattcaat      2160
     cccatcaagc gcatgaagaa ggagcacgca gagaccgctg agaggttgat tatgctgaat      2220
     ggaggtatcc ccccacccta caagactttg ccaacttggg acatcgcgga cggcagcgaa      2280
     gagaagacgt acgatgagat gttcaaacag cccgtcgccg ttcccacagt accaccccag      2340
     ggtcggtccg tctctaacaa caccaatatt ccccagcaac atcaggtgcc cttccacttc      2400
     cagcaaggta acccagccat gccgccatct tctggccctt cgaatggacc tcatggcctt      2460
     cattctcagg gtccccatgg cccctcccat gtggatgatc atcaccgcat gcagttatcc      2520
     gcgtcgaact cccaggtttt cccgtccccg cggatgcaac atggataccc atcccctatg      2580
     gctccccatg cccagctttc cttcccacaa ccggtcccgc agttttacgg cgggccccaa      2640
     cctggccata tcagaccttt ccagggtggt ggtcctcagt ttgtgaatgg cgctcctatg      2700
     atggtgcagc aggcctcgaa tggaccctac atgggagtcc cgcaaggcat gtctccctat      2760
     aacgcacaga tgccaatgta ctccccgaac ccaggccacg cctatcccca acatacaccc      2820
     cagcctcata gtgggtaccc aagcccgagc cgtggtgcgc ccatgatgat gcaccagaac      2880
     tcgcaatctg gacagcctcc tcaatcaatg atgtttatgc ccggccaacc cggttaccct      2940
     cagcagtcgg gacacatgcc tcccaaccgt ggcaactacc cacagcagcc tcacttttcc      3000
     tcaagtcccc atcaatcgca tcatttccca cctaaccagc atcggacacc cagcaacggt      3060
     ttcaaccaaa tgcctcaaat gccaccccag atgcctgccg ctaccccagc aacaacccct      3120
     ggagcttctc acccggccga ggcaacggat gaaggaaaat ga                         3162
//

If you have problems or comments...

PBIL Back to PBIL home page