(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_13.PE34

PENCW_13.PE34        Location/Qualifiers
FT   CDS_pept        join(74801..75681,75748..75859)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000196153" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15945517"
FT                   /orf_name="Pc16g00340"
FT                   /product="Pc16g00340 protein"
FT                   /function="binding"
FT                   /function="oxidoreductase activity"
FT                   /biological_process="oxidation-reduction process "
FT                   /protein_id="CAP92704.1"
FT                   /db_xref="GO:0005488"
FT                   /db_xref="GO:0016491"
FT                   /db_xref="GO:0055114"
FT                   /db_xref="InterPro:IPR002198"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="UniParc:UPI0001831E93"
FT                   /db_xref="UniProtKB/TrEMBL:B6H6U5"
FT                   /transl_table=1
FT                   /translation="MVNIIQPKVDPLPTGIDLTGKTVVITGASAGMGLEATKQLLRLRA
FT                   STVILAVRNVAKGEACATSLRQDRRIQTHNPNPTIKVMALDVDDYHSVQRFTKQLREEI
FT                   PVVHILILNAGIGLLKLERSASGHDRTTQVNYYSNVLLIAELLPYLQAGAEKTGFPARI
FT                   SWVGSRAHEVTSLEKKAPIKPGEGVLAHMDKEEAFVPFQRYGDSKLLCVMFMYSLAPRL
FT                   DPKKVIINMMCPGMVNTNMSDVLPMHLRLIVNVVKSFRARPVEVGGWIILNSALVVGPE
FT                   SHGKFLNDKTISDKSAFIKSPAGQEIQKKLWEETIAEIGTLTPLPAEFK"
     atggtcaaca tcatccagcc gaaagtcgat cccctaccta cgggcattga cctgacgggt        60
     aaaactgtcg tcattaccgg tgccagcgcc ggaatgggtc tggaagccac caaacagctc       120
     ctgcgactgc gcgcctcgac cgtgattctt gctgtgcgca atgtcgccaa gggcgaggcc       180
     tgcgcaactt ccctccgcca ggaccgtcgc attcaaactc acaatcccaa cccaaccatc       240
     aaggtcatgg cacttgatgt ggatgattat cacagtgtac aacggttcac gaagcagctc       300
     cgcgaagaga ttccggtggt ccatatcctc attctcaatg cgggtatcgg tctgctcaag       360
     ctggaacgca gcgcaagcgg ccatgaccga actactcaag tcaattacta ctccaatgtt       420
     ttgctgatcg ccgagctcct gccgtatctc caagcaggcg cggagaagac cggctttccg       480
     gctcgcatta gctgggttgg aagtcgcgca cacgaggtca ccagcttgga gaagaaagct       540
     cctatcaagc ccggtgaagg tgttcttgcg catatggaca aagaagaagc atttgtccca       600
     ttccagcgct atggggattc gaagctactt tgcgtgatgt tcatgtacag tctggcgccg       660
     cgactggatc ccaagaaagt catcatcaac atgatgtgtc cgggcatggt gaacaccaac       720
     atgagcgatg ttctccccat gcacctgcgc ttgattgtga atgttgtcaa gtcatttcgc       780
     gccaggcctg ttgaggtggg tggctggatc atcctgaata gtgcgctggt ggtaggccct       840
     gagtctcatg gcaagttctt gaatgacaaa accatttctg ataaatcggc gttcatcaaa       900
     tcaccggctg ggcaggagat tcagaagaaa ctgtgggagg agacaattgc cgagatcggc       960
     acattgaccc cccttcctgc cgagttcaag tag                                    993
//

If you have problems or comments...

PBIL Back to PBIL home page