(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_13.PE340

PENCW_13.PE340       Location/Qualifiers
FT   CDS_pept        join(complement(775039..775141),complement(774656..774781),
FT                   complement(774180..774448),complement(773994..774101),
FT                   complement(773758..773905),complement(773527..773666),
FT                   complement(773363..773426),complement(773044..773228),
FT                   complement(772518..772643))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15947698"
FT                   /orf_name="Pc16g03400"
FT                   /product="Putative uncharacterized protein Pc16g03400 "
FT                   /protein_id="CAP93010.1"
FT                   /db_xref="UniParc:UPI0001831EA4"
FT                   /db_xref="UniProtKB/TrEMBL:B6H940"
FT                   /transl_table=1
FT                   /translation="MWQVGDCLGCPGARVGAANGQGFNMRPVVRMRSIVNAHSHQSTVD
FT                   SPIEQSKCPVAFPRVSIQPATQVALSNDANSELCSDHDDILLRSHSRQPTSHNNIPTAW
FT                   PPLFQQNTNVSRRNAGTLQRDPSQRTHGWWPRWTKRRWSWIMGDIVYIYASVRPELVSQ
FT                   LGLVHLGIVSLKCFGDSVHRAGSMARESMGNGEAAPLSGGKVWVVGGNSYGVLGGLGVE
FT                   RILAGGVLLAMRNTGFSIVFSPTPWGGIPNGEVCWLGCGLEVFGFCDAWWCFGGLFWGL
FT                   FMAGVWAEESAMGRSTAGWFAAADICNSYLASSTSTVSGGHRSVGAICTVKFTHLQPHV
FT                   TASLAPPDRSPSSTSPFDQPSSPPRRNPLQTYFPPWKMQSPNSNVLRTASVTGKQMKTR
FT                   SWKSNRGIGVGGCQQCRARASHS"
     atgtggcagg tcggggattg tttggggtgt ccgggtgcgc gagtcggggc ggccaatggc        60
     caagggttca atatgcggcc ggttgtcagg atgagatcaa tagtcaacgc tcactcacac       120
     cagtcgacag tcgatagtcc tattgaacaa agtaagtgcc cagttgcttt cccacgcgtt       180
     tcaatccaac cagcgacgca agtcgccctc tccaatgatg cgaactctga gctgtgctca       240
     gaccacgacg acatcctcct ccggtcacac tctcgacaac caacttcaca taacaacatt       300
     cccacagctt ggcccccgct cttccagcag aacacaaacg tctcccgtcg gaacgctggc       360
     acgctgcagc gggatcctag tcagcgcacc catggctggt ggccacgctg gacaaagcgg       420
     cgttggtcct ggatcatggg agacattgtg tacatttacg cttctgtccg tcctgaacta       480
     gtatcgcaac tgggattggt ccacttgggg attgtgtcct tgaagtgttt cggtgatagt       540
     gtgcatcgtg ctgggtctat ggcgcgagaa agtatgggaa acggggaagc ggcgccgcta       600
     tctgggggga aggtttgggt ggttggggga aactcttatg gtgttcttgg ggggctcggg       660
     gttgaacgta ttcttgctgg cggcgttctg ttggctatgc ggaatacggg cttctctata       720
     gtcttctctc cgactccttg gggtggcatt cctaacggag aggtgtgttg gttggggtgt       780
     gggctggagg tgtttggttt ttgtgatgct tggtggtgtt ttgggggttt gttctggggc       840
     ttgtttatgg ctggagtgtg ggcagaggag tctgcaatgg gacgaagcac cgcggggtgg       900
     ttcgcagctg ctgacatctg caacagttat ctggcatctt cgacatcgac ggtatctggc       960
     ggccataggt ccgttggagc tatctgtact gtcaagttca cgcatcttca accacacgtc      1020
     actgcttcgc ttgctccccc agaccgatca ccttcatcca catcaccatt cgaccaacca      1080
     tcgtctccac cgagacgcaa cccattgcag acctatttcc ctccatggaa gatgcaaagt      1140
     ccgaattcaa atgttttgag gaccgcgtcg gtgacgggga aacagatgaa gacgcggtcg      1200
     tggaagagta accggggtat tggagttggc ggttgccaac aatgcagagc gcgggcaagt      1260
     cacagctaa                                                              1269
//

If you have problems or comments...

PBIL Back to PBIL home page