(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_13.PE341

PENCW_13.PE341       Location/Qualifiers
FT   CDS_pept        join(775158..775280,775353..775490,775548..775658,
FT                   775718..775864,775934..776307,776371..776665,
FT                   776716..776919,776970..777142,777195..777960)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000208340" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19824341"
FT                   /orf_name="Pc16g03410"
FT                   /product="Pc16g03410 protein"
FT                   /function="ATP binding"
FT                   /function="protein kinase activity"
FT                   /biological_process="protein phosphorylation"
FT                   /protein_id="CAP93011.1"
FT                   /db_xref="GO:0004672"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0006468"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR011989"
FT                   /db_xref="InterPro:IPR016024"
FT                   /db_xref="InterPro:IPR017442"
FT                   /db_xref="UniParc:UPI0001831EA5"
FT                   /db_xref="UniProtKB/TrEMBL:B6H941"
FT                   /transl_table=1
FT                   /translation="MDFLKSAIGSAIAKGGGLPFSLGDRVDIGDTVWALHNGTKRDDGS
FT                   ACSVFAFDINGNKSRLPLAKNAVRKSRTLRHPGVIKVLDTIETEHNLYIVTERVVPLSW
FT                   PVKRRSLSEETAKWGLYTVASTLKFINDDAASVHGAVRASSVFTSESGEWKLGGFDILS
FT                   SMKEDDAIIYTYGSSVPDAARYTPPEVVKTGWDTIKRNPLAAVDAYGLGILIFEVFNGG
FT                   FSGGDQAGKTTNIPPSMQQSYKRLCTANPKLRLSPGHFVEQGKKQGGFFQTPLIRMTED
FT                   IDSLGLKNDAEREEFINELDDLSGDFPEEFFKMKVLPELLKSVEFGGGGPKVLGATLKI
FT                   GAKLSAEEFNAKLTPVIVRLFGNPDRALRVCLLDNLPSMIDNLPQRVVNDKIFPQMTSG
FT                   FTDVAPVVREQTVKAVLTIVNKLNDRIVNGELLKFLARTANDEQPGIRTNTTICLGRIA
FT                   KNLSQSTRSKVLIAAFTRSIRDPFVHARNAGLLALSATIDVFSEEDCAVRILPAICPAL
FT                   LDKEKLIRDQANKTLDLYVQRTRKYASTMPDTVLPPAAPAEVNKPDARVGTPSDNSWAG
FT                   WAISSFTNKIATANGEIEPTANTNKTLDPDTARSASVPRPSKPTPPTELPKQVLRPTAQ
FT                   PLNRSMSDRPAPVVHDEEPEEEGDDVFDAWGAMDDDEKDDDPFTAAVATPKPTSPVPSS
FT                   TKAPVVPYDDGGEPDFAGWLAAKSQTKAKNPLPKGLTKTASANAVTTRSTISSAKPRTV
FT                   VAPKKIDTKPKDEEADDWGDAWD"
     atggatttcc tgaaatcagc catcggatca gccatcgcga agggcggagg gctcccgttc        60
     tccctcggcg acagagtcga tatcggtgat acagtctggg cactgcacaa cggtacgaaa       120
     cgggatgacg gttccgcttg cagtgtcttt gcatttgaca tcaatgggaa caagtcgcgc       180
     ctccctcttg cgaaaaatgc cgtgcgcaag tctaggacgt tgcggcatcc tggtgttatc       240
     aaggttttgg atacgattga gacggagcac aatctttata tcgtcaccga acgagtcgtg       300
     ccactgagct ggccggtgaa gcggaggagc ttaagcgagg agacggccaa gtgggggttg       360
     tatactgtgg cgtctactct caaattcatc aacgacgatg ctgcctcggt tcatggcgcc       420
     gtgcgcgcat cctcggtgtt cacaagcgag agcggcgaat ggaagctagg tggattcgac       480
     attctgagct ctatgaagga agatgatgcg atcatatata cgtacggaag tagtgtgcct       540
     gatgccgctc gatacacgcc accggaggtt gttaaaacag gatgggatac tatcaagcgc       600
     aatcctctgg cagcagttga tgcctatggg ctgggtattt tgatcttcga ggttttcaat       660
     gggggcttct cgggcggcga tcaagctggc aagacgacaa acattcctcc cagcatgcag       720
     caaagctata agcgtctttg caccgccaac ccgaagctac gactgagccc ggggcatttc       780
     gtggagcagg gaaagaaaca aggtggattc ttccagacac cactcattcg aatgaccgaa       840
     gacatcgaca gcttggggct caagaatgac gccgagcgtg aagaatttat taatgagctt       900
     gatgatcttt ctggagactt cccggaggaa ttcttcaaga tgaaggtgct cccggagctg       960
     ctgaagtccg tcgaatttgg cggcggtggg ccgaaagttc ttggagctac cctgaagatt      1020
     ggagcaaagc tgtcagcaga agaattcaac gctaagctga ctcctgttat tgtccgctta      1080
     tttggcaacc ctgatcgagc attgcgggtc tgcctcttgg ataaccttcc gtcaatgatc      1140
     gataaccttc cccagagggt tgtcaacgac aaaatattcc cccaaatgac ttctggcttc      1200
     actgatgttg ccccggtggt tcgagaacag acggtcaagg ctgttttgac catcgtcaac      1260
     aaactcaatg ataggattgt caatggagaa ctcttgaagt tcttggctcg cactgctaat      1320
     gatgagcaac ctggcattcg gacaaacacc acaatttgtc ttggccggat tgctaagaac      1380
     ctaagtcaaa gtactcgctc caaggtgctt attgcggcat tcacgagatc tatcagagac      1440
     ccatttgtcc acgctcgaaa cgcaggactt ttggctctgt ctgcgactat cgatgtattt      1500
     agcgaggaag attgtgctgt taggatcctg cctgccattt gccctgcact tttggacaag      1560
     gaaaaattaa tccgcgacca agcaaacaag acactcgact tgtatgtcca gcgcacacgg      1620
     aaatatgcca gcacgatgcc agacactgtc ctaccccctg ccgcacccgc agaagtcaac      1680
     aaacccgacg ctcgtgttgg aacccccagt gataactcct gggccggctg ggccatttca      1740
     tcattcacga acaaaattgc gacagctaac ggcgagattg aaccaactgc caacactaac      1800
     aagactcttg accctgatac tgcccgctca gcgtcggtcc ctcgtccctc caaaccaaca      1860
     cctccaaccg aactaccaaa acaagtactc cgtcccacag ctcagccctt gaaccggtca      1920
     atgtcagatc gtccagcccc ggtcgtccac gacgaggaac ctgaagaaga gggcgatgac      1980
     gtcttcgatg cttggggtgc tatggacgac gacgaaaaag acgacgaccc gttcactgcc      2040
     gctgtagcta cccccaaacc cacatctcct gttccctcat cgaccaaagc ccccgtggtg      2100
     ccctacgatg atggcggcga acccgatttc gccggctggc tagccgcgaa gtcccagacc      2160
     aaggctaaga atcccctacc caagggtttg accaagactg cttctgccaa cgccgttacc      2220
     acacggtcga cgataagctc tgctaagcct cggactgttg ttgcacctaa gaagatcgat      2280
     actaaaccca aagacgagga ggccgatgat tggggagatg catgggacta g               2331
//

If you have problems or comments...

PBIL Back to PBIL home page