(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_13.PE342

PENCW_13.PE342       Location/Qualifiers
FT   CDS_pept        complement(778253..780637)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19824342"
FT                   /orf_name="Pc16g03420"
FT                   /product="Pc16g03420 protein"
FT                   /protein_id="CAP93012.1"
FT                   /db_xref="UniParc:UPI0001831EA6"
FT                   /db_xref="UniProtKB/TrEMBL:B6H942"
FT                   /transl_table=1
FT                   /translation="MSKGKRRRRHSKAVQQTQPPAPSLPTPVTEPGRQRKRKRNHHKAK
FT                   KRPLSSSQVYRKDGLNSESPQGGSSNHPPTDQERKNPRSVHSSQVKVQEQRSPAKRSTT
FT                   PLQRAPKTKGGYGSDSEFEFEYINKAQAQLKPRVALRSPPSSPQKVAGPKNTTPVSGNE
FT                   RGNDVRAISADGDSESERERELASPSPLLPSPQRALPLENTTPVSNHDRQRTSRGASLS
FT                   NTTLESQPVFTPEPERRSSQSSGTSLERVVGHEEATPASYSVYGHRIRESSASDTDVEP
FT                   ENASEAEPGHGPEWSLSSSSPCNKTARNRKRPNAHIASRRKAAPLPAPSSLDCLPEIES
FT                   EPTLPSMDNLTFSESALRNFRVDHWRKACEPKEPPLPSRSDLSKVIGPSSPSVFVLMSE
FT                   FQPPESEVESRYASPSPTQITPASSPPVPPTVPRVRSRVRSRLPSPQRWLSRLGRPVQK
FT                   PALRETVWTSRLRPTCEIYFTNKPLLINSMRYPHLSAEFPPDAHGNPEFEFWDNSDDDS
FT                   DFELPEDIEPPEAKRRRLWSSEDSPETELAERESSLESEELSELELLESSEPEAHIDLE
FT                   PLLLDIAGSSDPQPLPELERSSDTGRSSNRESEHPHPPTSIRDELPVRQSRQLNKRIDE
FT                   AIARDKEENPKFWGGSWMKEYERGVPIKERAEAEYKEEMAKKKEEAETKKREKQERDRI
FT                   LKEKRERKRKEMAEQKVRLEREKQKRMEEQERQQKERQKREELERRRAKARAGKRPKNV
FT                   ESALQEMLDERETTDVEMSVDPEGLKVAQTAYRLYMRKKAR"
     atgtcgaaag gaaaacgccg ccgccgccat tcaaaggccg tccagcaaac ccagccaccg        60
     gcaccctcgt tgccaactcc agtgacggag ccaggccggc agcggaagcg gaagcgcaat       120
     caccacaagg ccaaaaagcg gccactatcg tcttcgcaag tgtacagaaa agatggattg       180
     aactcggaat caccacaggg cgggtcatcc aatcatccgc ccacagacca ggagcgaaaa       240
     aacccacgat cggttcatag ctctcaagtc aaggttcagg agcaaagatc accagccaaa       300
     cgttcaacga caccattgca gcgtgcgcct aagaccaagg gagggtatgg atctgattct       360
     gagttcgaat tcgagtatat aaacaaggcc caggctcaat tgaagccgcg agtggctttg       420
     cgatcacctc catcatcacc acaaaaggta gcgggaccca agaataccac gccagtttct       480
     ggcaatgagc gcggcaacga tgtccgtgcg atatcagcag atggagactc agagtctgaa       540
     agggaacgcg aactagcctc gccatcgcca ttacttccct cgccgcaaag ggccctacct       600
     ctcgaaaata ccacgccagt ctctaatcac gaccgccagc gcacttctcg tggggcatcg       660
     ttgtcaaata caacattgga atcacagccg gtctttacac cagaaccaga acggagatca       720
     tcccagtcat caggaacatc gctggaaaga gtcgtgggcc acgaagaagc tacaccagct       780
     tcctattctg tctacgggca tcgaatccgt gaatcatcag catcagatac tgacgttgag       840
     cctgaaaatg catctgaagc agaaccgggc catggcccgg agtggtccct gtcgtcgtcc       900
     tcgccgtgca ataagacagc ccgaaaccgg aagagaccaa acgcccacat tgcgtcccga       960
     cgcaaagcag cgccattacc tgctccttcg tcactggact gtctgcctga aattgaatct      1020
     gaacctacat tgccatcaat ggataacctc acattttccg agtcagcctt acggaacttc      1080
     agagttgatc actggcgcaa agcctgcgag ccaaaagaac caccattacc ctcccgatca      1140
     gacttgtcta aagtgatagg accctcgagt ccgtcagtat ttgtactcat gtcagaattc      1200
     caaccaccgg aatctgaagt tgaatctcga tatgcgtccc cgagtccaac tcaaataaca      1260
     ccagcgtcgt ctccacccgt acctccgact gtcccacgag tgcggtctcg agttcgttct      1320
     cgacttccct cacctcaacg ctggttatcg agactcggac ggccagtgca aaagccggca      1380
     ttaagggaga ccgtctggac ctcgcgtctc cggcctacat gtgagatata tttcaccaac      1440
     aagcctctcc tgataaacag catgagatat ccacaccttt ctgccgaatt tccgcctgat      1500
     gctcacggga atcccgagtt cgagttttgg gataactcag atgatgattc tgatttcgag      1560
     cttccagaag acattgagcc tccggaagct aaacggcgta gattatggtc atctgaagac      1620
     tcgccagaga cagagttggc agagcgagag tcatccctgg agtccgagga gttatcagag      1680
     ctcgagctgc tcgagtcgtc agagcctgag gcacatattg atcttgagcc attattgctc      1740
     gatattgcag gctcgtcaga tccgcagcca ttgcccgagc ttgaaagatc atcagacaca      1800
     gggagatcat ccaatcgtga gagcgaacat ccccatccgc ctacttcaat ccgggatgag      1860
     ttaccggtac ggcaatcgag gcaacttaac aagcggatcg atgaagcgat tgcgagagat      1920
     aaggaagaaa atcccaagtt ctggggtggt tcatggatga aggaatatga gagaggtgta      1980
     ccgataaaag aacgggctga ggccgagtat aaggaagaga tggcgaagaa gaaagaagaa      2040
     gcggaaacaa aaaaaaggga aaagcaggag agggatagga ttctgaagga gaaaagggag      2100
     cgaaagcgaa aagaaatggc agagcaaaaa gtgcggctgg agagggagaa acagaagaga      2160
     atggaagagc aggagaggca gcagaaggag agacaaaaga gggaggagct ggaacgacgg      2220
     agagcaaaag ccagggcggg gaaaaggccg aagaacgtgg aatcagcgtt gcaggagatg      2280
     ttagacgaga gggagactac ggatgttgag atgtcggttg accctgaggg gttaaaggta      2340
     gctcagactg cgtacaggtt gtatatgcga aagaaggcaa ggtaa                      2385
//

If you have problems or comments...

PBIL Back to PBIL home page