(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_13.PE347

PENCW_13.PE347       Location/Qualifiers
FT   CDS_pept        join(790621..791033,791093..791204)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000201293" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19824343"
FT                   /orf_name="Pc16g03470"
FT                   /product="Pc16g03470 protein"
FT                   /protein_id="CAP93017.1"
FT                   /db_xref="UniParc:UPI0001831167"
FT                   /db_xref="UniProtKB/TrEMBL:B6H946"
FT                   /transl_table=1
FT                   /translation="MVHQTDMLAPPEAASFYITPEYADKLANKTIPWVRQKLDTDNLGD
FT                   RLFATSRVQEADPDDILQRNKYRTIILGALMIRAGARIKAADLQHLRDLVPQINCTSRR
FT                   MLFDHGFRTPGKVQFLAALDYYQPGVPRSFQEPSCFMCGKIEDDIGHTPLQCKKCKVAT
FT                   YCGKVSRMDTS"
     atggtccacc aaaccgacat gctcgcacca cccgaggctg cttccttcta catcacccct        60
     gaatacgccg acaagctagc caacaaaacc atcccgtggg tccgccaaaa gctcgacact       120
     gacaacctcg gagaccggct gtttgctacg agccgtgtcc aggaagcaga cccggacgac       180
     atccttcaac gaaataagta ccgcactatc atcctgggtg ctctcatgat ccgcgctggt       240
     gctcgtatca aggcagcgga tctgcaacat ctacgtgatc tagtgcccca aatcaactgc       300
     acctcccgcc gaatgctctt tgaccatggt ttcagaactc cagggaaagt tcagttcctg       360
     gctgccttgg attactacca gcccggtgtt ccacgtagct tccaggagcc tagctgcttc       420
     atgtgcggaa agatcgagga tgatatcggt cacacacctc tgcaatgcaa gaagtgcaaa       480
     gtcgcaacgt actgcggcaa ggtaagcagg atggatacaa gctaa                       525
//

If you have problems or comments...

PBIL Back to PBIL home page