(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_13.PE348

PENCW_13.PE348       Location/Qualifiers
FT   CDS_pept        792281..793333
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000076676" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20671660"
FT                   /orf_name="Pc16g03480"
FT                   /product="Pc16g03480 protein"
FT                   /protein_id="CAP93018.1"
FT                   /db_xref="UniParc:UPI0001831168"
FT                   /db_xref="UniProtKB/TrEMBL:B6H947"
FT                   /transl_table=1
FT                   /translation="MTRLTTIFTTLYALYSLPLISAWTFVWRNAANNPTVEKGTDAQSC
FT                   KAIDHAKGKDFKFDAEDSLFRIYMYGSPNCTDDNIESAEDYLARNSTSPLRAFAVIDLR
FT                   GANTSTGGELTPFPGADWFKSSPNSPIITAMGERLVAENCGKYRVGPGPQWSEVDRESY
FT                   QCWQKKLGYTGTDANGWPGKTTWDQLKVSLTDGNDGGSSKTTETPPSATTSTATSTGTG
FT                   TGTGTPTSTSVPDTDTSSGSALSGGEIAGSVVGSVAGLGLVGAMIYLSRRIFRHRAPAS
FT                   GDEGPEPDSEGGAMAVGGSKRWAREKLPFEVEADPAKNRKKYISELPGDTAAAELSDSR
FT                   RVLELGDSRT"
     atgacccgtc tcacaaccat tttcacaacg ctatacgcac tctactctct cccactgatc        60
     tccgcctgga ccttcgtctg gagaaacgct gccaataacc ccaccgttga aaagggcacc       120
     gacgcacaga gctgcaaggc gatcgaccat gcaaaaggca aagattttaa gttcgacgcc       180
     gaagacagtc tctttcgcat ctatatgtat gggtcaccca attgtacaga cgataatatc       240
     gagagtgccg aggactatct cgcgaggaac tcgactagtc cgcttcgagc atttgcggtt       300
     attgatttaa gaggggcaaa tacgagcact ggtggtgaac tcacgccgtt cccgggagca       360
     gactggttca agtcatcccc caacagccct atcataactg ctatgggaga gagactggtg       420
     gcggagaact gtggaaagta ccgcgtggga ccagggccgc agtggtccga ggtagaccgc       480
     gagtcctacc agtgttggca aaagaagctt gggtataccg gtacggacgc caatgggtgg       540
     ccagggaaga cgacttggga tcaactcaag gtgtctctga cggacgggaa cgacggagga       600
     tcatctaaga ccacggagac gccgcctagt gcgactacga gtacggctac gagtacagga       660
     acgggaacgg gaacaggaac gccgacaagt acatcagtcc cggatacaga tacctcctcg       720
     gggtcggcac tcagcggagg ggagattgct gggtccgttg taggctctgt ggccggattg       780
     ggacttgtag gggccatgat ctatctctcg cggcggatat tccgacaccg tgctccggcg       840
     tctggagatg aagggccaga gccagattca gagggtggtg ctatggcagt aggaggatcg       900
     aaaaggtggg cgagggagaa gctgccgttc gaggttgagg cggaccctgc aaagaatcga       960
     aagaagtata tctctgagct tccgggagac acggcggcgg cggagttgag tgatagtcgg      1020
     agggtccttg agctgggaga cagtcggaca tag                                   1053
//

If you have problems or comments...

PBIL Back to PBIL home page