(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_13.PE35

PENCW_13.PE35        Location/Qualifiers
FT   CDS_pept        complement(76039..77334)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20671089"
FT                   /orf_name="Pc16g00350"
FT                   /product="Pc16g00350 protein"
FT                   /protein_id="CAP92705.1"
FT                   /db_xref="UniParc:UPI0001831E94"
FT                   /db_xref="UniProtKB/TrEMBL:B6H6U6"
FT                   /transl_table=1
FT                   /translation="MAETDASSWKPTTLESKPFSLDSGHYTALAFVLAVCVPQAPHGTL
FT                   LRYGLLLLQITCAVQAFLVQPPPVSDRAVLYTSGVLMGNLLARYFDRLYTTVPERTFHR
FT                   IIDSQSPEDTVRLSAPKRLFWALELFSVTRGIGWNWRVAGIPKSPVSTTRFQFAAAQLL
FT                   RWTAMYAGLHLVNVTCQVVSSNPNASPSLPGNLHIYALIVCGFAITIYSHFAILMLPLS
FT                   ALCVGLQVGPRSWQDIASWPPNFGSVREAYSIRRFWGYTWHQQLRRQAGAPGAYLISLL
FT                   PDSVTTSKQTSVRLARRYSLLMMSFVISGLIHACGTYQVTRALGLPLSDGGEMKYFTLQ
FT                   GMAIIAEDFGCWVLGIDDRGTQPGVMRRWMGYAITLSWYVWSRVQLKGVPVALAMGIED
FT                   ERGDLFAALELVRLSAAAVPGNFVATAWELIW"
     atggctgaaa cggatgcttc ctcgtggaaa cccacgacgt tggaatcgaa gccgttctcc        60
     ctcgacagcg gacactatac agctctagcc ttcgtcctcg ctgtctgcgt cccacaggcc       120
     cctcatggaa ctttacttcg ttacggactg cttcttctcc aaattacttg cgcagtacag       180
     gcattccttg tccagccacc cccagtatca gaccgggccg tcctctacac gtcgggtgtt       240
     cttatgggca atctgctagc gcgctacttt gaccgattgt acacgaccgt cccggagaga       300
     acattccacc gcatcatcga ctcccaatct cctgaggata cagtccggct ttcggcgcct       360
     aagcgccttt tctgggccct ggaactcttc agcgtcaccc gcggtatcgg ctggaactgg       420
     cgcgtcgccg gcattcccaa atccccggtg tcaaccacca gattccagtt cgctgcagcc       480
     cagctcctca gatggactgc tatgtacgcg ggtctacatc tcgtcaacgt aacctgtcag       540
     gtcgtctcgt caaacccaaa cgccagcccc tcgcttccgg gtaatttgca catctacgcc       600
     ctgattgtgt gcggctttgc catcacaata tacagccatt tcgctatttt aatgctcccg       660
     ctctcggctc tctgtgtcgg cctccaagtc ggccctcgct cgtggcagga tattgcctcc       720
     tggccaccca atttcggtag tgttcgcgaa gcatacagca ttcgccgatt ctgggggtac       780
     acttggcacc agcagctgcg acgacaggct ggtgcgcctg gtgcatatct catcagcttg       840
     ttgccggaca gtgtgacgac gtctaaacaa acgtctgtta gactagcgag acggtactca       900
     ctcctcatga tgagttttgt catctcaggg ttaatccatg cgtgcggaac ctaccaagtg       960
     acacgagcgc ttggcctgcc tttgtcggac ggcggggaga tgaagtattt cacgttacag      1020
     gggatggcaa tcatagccga ggatttcggt tgttgggtat tgggtattga cgatcgggga      1080
     acacagcctg gggtgatgcg gagatggatg ggatatgcaa tcacgttatc ttggtatgtc      1140
     tggagtcgcg tgcagctgaa aggagtgccg gtagctctgg cgatggggat tgaagatgag      1200
     aggggggact tgtttgctgc gttggaactg gttcggctgt ctgctgcagc ggtgccgggc      1260
     aattttgtgg cgacggcctg ggagctgatt tggtga                                1296
//

If you have problems or comments...

PBIL Back to PBIL home page