(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_13.PE352

PENCW_13.PE352       Location/Qualifiers
FT   CDS_pept        complement(801679..803790)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000216303" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15947702"
FT                   /orf_name="Pc16g03520"
FT                   /product="Pc16g03520 protein"
FT                   /function="ATP binding"
FT                   /function="two-component response regulator activity "
FT                   /function="two-component sensor activity"
FT                   /biological_process="peptidyl-histidine phosphorylation "
FT                   /biological_process="regulation of transcription, DNA-
FT                   dependent"
FT                   /cellular_component="membrane"
FT                   /protein_id="CAP93022.1"
FT                   /db_xref="GO:0000155"
FT                   /db_xref="GO:0000156"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0006355"
FT                   /db_xref="GO:0016020"
FT                   /db_xref="GO:0018106"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR000700"
FT                   /db_xref="InterPro:IPR001610"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR009082"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR013767"
FT                   /db_xref="UniParc:UPI0001831169"
FT                   /db_xref="UniProtKB/TrEMBL:B6H948"
FT                   /transl_table=1
FT                   /translation="MALTSGLQALTVDDTSRPACKPLITTPVGEEETAPAEPNRSSNSK
FT                   EKKMETPQECVGLDASLSRIYRYHPIPTLIVDKSLCVVEVSDSHCAFSGQSRDELVGTC
FT                   VCDVPVHTIPAPDTPTLYGALRTAIVSEKVQILDGIHVKSKNSIYQLRITPIFEKSSLI
FT                   YVVLEAQNAPQDHCVGTDEQHANMNEIYKILVDTMKDYAIFMLDTRGNVTTWNLGAELL
FT                   KGYSPSEIIGKHFSIFYSPADLDIDKPGRGLARALRQGRMEDEGWRYRQDGSRFWANVL
FT                   ITPIYQLGRHMGFVKVTRDLTERKAAEQRMIVAFEESAKMKTDFLANMSHELRTPMNGM
FT                   QLALAMMKDSDLTEQQLEYASIIEDSTSVLLRIINDVLDYSKLSSGSFSLHSDVVEIKG
FT                   ILDAVMRNCRSLLKPGVELSCLIPPDLPKFMRGDPLRYRQVIQNMLGNSVKFTETGYIR
FT                   VSTTFSPVESDPETYTVTTEFADSGVGIPDCALNTLFTPFTRFADSSTRKYQGTGLGLS
FT                   ICKSLAELMDGTVGYRPGPQNKGSVFWFTARMGRVGTGYSNAQPAIPSTDDAKDLLNRV
FT                   RGIAPRKRVLLVEDNLVNQTVMLKLLQSLEFERIDVAGDGAEAVRQVKQTPLSYNVVLM
FT                   DISMPVTDGLEATSQIRGMGIDVPIVALTANALKGDMETYLANGMNDYIGKPVNRDQLL
FT                   QVLWKWIGA"
     atggctctca ccagcggtct ccaggctctt actgtggacg ataccagtag gccggcctgc        60
     aagcctctta tcacaacgcc tgtaggagaa gaggaaacgg caccagcgga acccaaccgg       120
     agctcaaatt caaaggagaa gaagatggag acgccgcagg aatgcgtagg tctcgatgcc       180
     tccttgagtc ggatttatcg ttatcacccg attcctacct tgattgttga taagagtttg       240
     tgtgttgtgg aggtttcaga cagtcattgt gccttctcgg gtcaatctag ggatgaactg       300
     gtaggcacgt gcgtttgcga cgttccggtt cacactattc ctgcgccaga cactcctact       360
     ctgtatggag cgttacgtac agctatcgtc tcggaaaagg ttcaaatcct ggacggcatt       420
     cacgtcaaga gcaagaattc gatttatcag cttcgcataa cgccaatctt cgaaaaatcg       480
     tcgttgatct atgtggtatt ggaggctcaa aacgccccac aagatcattg tgttgggact       540
     gatgaacagc acgccaacat gaacgaaatt tacaagattt tggtcgatac tatgaaagat       600
     tacgccatct ttatgctcga cacacggggc aacgttacca cgtggaatct tggcgccgag       660
     ctattgaagg gatattctcc ctcggaaatc atcggcaagc acttctccat cttctatagt       720
     cccgcggacc ttgatataga caagccaggt agaggtctgg cgcgggctct acgtcaagga       780
     cggatggaag acgaaggctg gcggtatcga caagatgggt cacgtttctg ggccaacgtg       840
     ttgatcacac ccatatatca acttggccgt cacatgggat tcgtcaaggt cacgcgtgac       900
     ctcacggagc ggaaggctgc cgagcaacgc atgatcgtag cctttgagga gtcagcgaag       960
     atgaagacgg atttcttagc aaacatgagc catgagttac ggacaccgat gaacgggatg      1020
     cagcttgcgc tcgcgatgat gaaggacagc gatcttaccg agcagcaact tgagtacgct      1080
     tcgataattg aggactcgac gtctgtcttg ctccggatca tcaacgacgt ccttgactac      1140
     tcgaagctat catctgggtc tttttctctt cactccgacg tcgtggaaat caagggcatt      1200
     cttgatgctg tgatgcgcaa ctgcaggtct ctcctaaaac ccggggttga gctgagctgt      1260
     ttgattccac cggacttacc taaatttatg cgcggtgacc ctttacggta tcgtcaggtg      1320
     attcagaata tgctcgggaa ctcagtgaag tttacggaga cgggctatat tcgagtctct      1380
     acgaccttct ctcctgtcga atcagaccca gagacatata cagttacaac agagtttgct      1440
     gactctggag ttggaattcc tgattgcgct ctcaatacac tcttcacacc atttacacga      1500
     tttgccgatt ccagtacccg caaataccag ggcactggcc ttggcctttc gatctgcaaa      1560
     agtttagcgg aacttatgga cggtacggtg ggctacagac ctggaccaca aaacaaaggt      1620
     agtgtgttct ggttcacagc caggatgggc cgtgtaggca caggctattc gaacgcgcaa      1680
     cctgccattc cttcaactga tgatgcaaag gacctcttga acagagtgcg gggaattgcg      1740
     ccccgcaagc gtgttttact tgtcgaggat aaccttgtca accagacggt aatgctcaag      1800
     cttcttcaaa gccttgagtt tgagcgcatc gacgtagccg gggacggggc ggaagccgtc      1860
     cgacaagtca aacaaacgcc tctgtcctac aatgtggttc tcatggacat tagcatgccg      1920
     gtgacagacg gtctggaagc gacatcgcaa atcagaggca tgggcatcga cgtgcctatc      1980
     gttgccctta cggcaaatgc gctaaaggga gatatggaga cgtatcttgc taatgggatg      2040
     aatgattata tcggaaaacc ggtcaaccgc gaccagctgt tgcaggttct ttggaaatgg      2100
     atcggggctt ag                                                          2112
//

If you have problems or comments...

PBIL Back to PBIL home page