(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_13.PE354

PENCW_13.PE354       Location/Qualifiers
FT   CDS_pept        join(complement(809678..809749),complement(809162..809611),
FT                   complement(808975..808980),complement(808788..808916),
FT                   complement(808623..808676),complement(808360..808519),
FT                   complement(808322..808329),complement(808056..808260),
FT                   complement(807395..807410),complement(807170..807365))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15947703"
FT                   /orf_name="Pc16g03540"
FT                   /product="Putative uncharacterized protein Pc16g03540 "
FT                   /protein_id="CAP93024.1"
FT                   /db_xref="UniParc:UPI000183116A"
FT                   /db_xref="UniProtKB/TrEMBL:B6H949"
FT                   /transl_table=1
FT                   /translation="MSLLLIHYIRNFGYTTKDGASSWQRKGPTALRKRCGDYPICYFNA
FT                   LSHDQEISGVQVASVSLRLPIYCAVNYSLSGINLWALRRYVRQFQPDNVERSRSSGLRA
FT                   AVHCAYETAPLSIFDNHKWRDPHLAPVGLFIYMLVGTKDIHHAIADDVDLVSLPANISL
FT                   LSPSIQYNALRWTHNAFIGAEVHIFGNFALQVPGSAILIHKCEADAFYLSSKTFSKKYL
FT                   EVQERPLEMIMDQLRIISLSKIELTWASFRHQRIPSGDSEVAQLLWFPEDISSRPAVGL
FT                   VPGSRKLTLGPKGTFVWVAPLCGNTAATLDHKDDLQVGIATIVKNPARLTYSIIVSITI
FT                   AQRPVRLWQTTAFARRIRLLEVILVSRLVQPLAAELHTKVMGYRPSALSFQQPLALPSI
FT                   CLWEVHFSILQGDLPREQPGISFSSYDPGERY"
     atgtctttgt tgctgattca ctacatcagg aatttcggtt acaccacgaa agacggtgcc        60
     tcctcatggc agcgcaaggg acctacggcg ttgagaaaaa ggtgtgggga ttatccgata       120
     tgttacttta atgccctttc ccatgaccag gagatcagtg gtgtgcaggt cgctagtgtg       180
     tccctccgac ttcccatcta ttgcgcggtc aactacagcc tttctggaat caacctctgg       240
     gctttgaggc gttatgtccg gcagtttcag ccggataacg tcgaacgtag tcgctcttct       300
     ggtctcaggg ccgcagtaca ttgcgcatac gaaaccgcac cgctaagcat ctttgacaat       360
     cataagtggc gtgatccgca cttggctcct gttgggttat tcatatacat gcttgtaggg       420
     actaaggaca tacaccatgc gattgcggac gatgtggact tggtcagctt gcccgccaat       480
     atctccctct tatcgccctc cattcaatat aatgctttac gatggacgca caacgccttc       540
     attggggcgg aagtccacat cttcggcaat ttcgcactgc aggtcccggg ttcggccata       600
     ttgatccaca aatgtgaggc ggacgctttc tacctctcca gtaaaacatt ttccaagaaa       660
     tacttggaag tacaagaacg cccactggaa atgatcatgg atcagcttcg aatcatttcc       720
     ctaagcaaga tcgagttgac gtgggcgtct ttccgccatc aaagaattcc tagcggtgac       780
     tcggaagtgg ctcagctttt atggtttccc gaggatatta gttccagacc ggcggtcggt       840
     ctagtcccag gctctcggaa actaactctt gggcccaagg gaacttttgt gtgggtcgcc       900
     ccgctttgtg ggaacactgc tgcgacccta gatcacaaag atgacctaca agttggaatc       960
     gcaactatcg tcaaaaatcc agctcgactt acgtacagta taattgtctc gattacgatc      1020
     gcacaaaggc ctgtcagact ttggcagacc accgcctttg ctaggcgaat tcgactcttg      1080
     gaagtcattc tagtttcacg cttagtccag ccacttgctg ccgaactaca tacaaaagtt      1140
     atgggttata ggccttccgc tctttctttc cagcagcccc ttgctttacc ctccatctgc      1200
     ctatgggagg ttcattttag tattcttcaa ggtgacttac cacgagagca gcctggtatc      1260
     tccttctcaa gctatgatcc cggggagagg tattga                                1296
//

If you have problems or comments...

PBIL Back to PBIL home page