(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_13.PE355

PENCW_13.PE355       Location/Qualifiers
FT   CDS_pept        join(809986..810007,810201..810266,810382..810489,
FT                   810587..810694,810788..811010,811113..811202,8
FT                   11638..811704)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18977571"
FT                   /orf_name="Pc16g03550"
FT                   /product="Putative uncharacterized protein Pc16g03550 "
FT                   /protein_id="CAP93025.1"
FT                   /db_xref="UniParc:UPI000183116B"
FT                   /db_xref="UniProtKB/TrEMBL:B6H7T5"
FT                   /transl_table=1
FT                   /translation="MDLWGEAGAIALMIIGDESRHWVQSLSDGVDPVKYPKLDFLSPTP
FT                   IPGDTAFLDRSPRQQQYNSGATGLDVAVASWAVTLPVVKTFTDYFTPASIRARDFAAKD
FT                   PRTYAPIVSHFLQQSLDDWMPSSVASCARLAAPWSCFTVSEAMPSIGIQFYRLVRNVLP
FT                   IEDFWSWVTSYSIRFYGICLADSTNASLSALSIHHPLFTLLSRGQSRDQHEQLSQSEPP
FT                   TYLPT"
     atggatctat ggggagaagc tggggcaatt gctctcatga taatcggtga tgaaagtcgt        60
     cattgggttc agtctttgtc tgacggagtc gatcccgtaa agtatccaaa gctagatttc       120
     ctatcaccca cgccaatccc tggagataca gccttcctcg atcgttcgcc tcgacaacag       180
     caatataatt cgggggccac cggattggat gtagccgtag cctcatgggc agtgacactt       240
     cccgtagtaa agacgttcac agattacttc acaccagcta gcatcagggc tagggatttt       300
     gcagcaaagg atccccgaac ctatgctcca atagtctctc attttttgca gcagtcgttg       360
     gatgattgga tgcccagttc ggtggccagt tgcgctcgtt tggctgcgcc atggagctgc       420
     ttcaccgtca gcgaggcgat gccatctatc ggcatccaat tctaccgttt agtgaggaat       480
     gtgttgccca tcgaagattt ctggagttgg gtcacatcat acagcattcg tttctacggc       540
     atctgtctgg ctgactcaac gaacgcgtcg ctaagtgctc tgtcgattca tcaccctctc       600
     ttcactttac tctctcgggg tcagtcacgt gaccagcatg agcagcttag tcagtctgag       660
     ccccctacct acctacctac ctag                                              684
//

If you have problems or comments...

PBIL Back to PBIL home page