(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_13.PE358

PENCW_13.PE358       Location/Qualifiers
FT   CDS_pept        816215..816769
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15947705"
FT                   /orf_name="Pc16g03580"
FT                   /product="Pc16g03580 protein"
FT                   /protein_id="CAP93028.1"
FT                   /db_xref="UniParc:UPI000183116D"
FT                   /db_xref="UniProtKB/TrEMBL:B6H7S3"
FT                   /transl_table=1
FT                   /translation="MRFTFAPDTFRLISHTQWLQTGFNLVLGCKLAVTGAKYAPRSPHV
FT                   RDLCSALNMPGVLRAALQRIQWLSKDRVTVDGKQHSKYFYEAWLCRILVWFEQKYHLVP
FT                   SEDTTQISTGPSTLANSATSQDVPLTGENYGATQVAQVDDTALWPDFLWNISTDDILNG
FT                   YMGFPDMPYPTLQPGYHVPLP"
     atgagattca catttgctcc tgatactttt cgactgatca gccatacgca atggctgcaa        60
     acaggcttta acctggttct aggctgcaaa ctggccgtca cgggggcaaa atacgcccca       120
     cgcagcccac atgttcgtga cctatgctcg gctttgaata tgccaggcgt tctgcgggcc       180
     gcgttgcaac ggatccaatg gctcagcaag gacagagtga ctgtagatgg aaaacagcac       240
     tccaaatact tctacgaggc atggctgtgc cgtattcttg tatggttcga gcaaaagtat       300
     cacctggtgc cctctgaaga tacgacccaa atatctacag gaccgtctac tttggccaac       360
     agcgcaacct cgcaggatgt ccccttgacg ggtgaaaatt atggcgccac acaagtagca       420
     caggtagacg atactgcctt atggccggac ttcctctgga acataagcac ggatgacata       480
     ctcaatgggt atatggggtt tccggatatg ccgtatccca cattacagcc tggatatcac       540
     gtgccactgc catga                                                        555
//

If you have problems or comments...

PBIL Back to PBIL home page