(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_13.PE360

PENCW_13.PE360       Location/Qualifiers
FT   CDS_pept        join(complement(817906..818299),complement(817614..817837))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000158505" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18977572"
FT                   /orf_name="Pc16g03600"
FT                   /product="Pc16g03600 protein"
FT                   /function="N-acetyltransferase activity"
FT                   /protein_id="CAP93030.1"
FT                   /db_xref="GO:0008080"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniParc:UPI000183116E"
FT                   /db_xref="UniProtKB/TrEMBL:B6H7S4"
FT                   /transl_table=1
FT                   /translation="MGSATNSLVLELATPEDIPAITEVWFASFTQPVIGKLFPNTPGMH
FT                   QWHRDWHLGDIQKPHHRYLRVVDTESKDEQGRPRLVAFGKWDLAMPDERGRRFPQWHAD
FT                   SPYQECEDFIAELEQARKRVMGDEKHYYLDTLGTHPDYQRRGAGSMLVQWGCDLADKDG
FT                   VAAYVDASKEGASLYLKHGFVNFNPPGSDVAAMARRKAAPSC"
     atgggatcag caaccaattc tctcgtgcta gaactagcca caccggaaga catcccagcc        60
     atcaccgagg tatggttcgc ttccttcaca cagccggtga tcgggaaact cttcccaaac       120
     acccccggca tgcaccaatg gcaccgggat tggcacctgg gagacattca aaaaccccac       180
     cacagatacc tgcgagtggt tgacaccgag tcaaaagacg agcaaggccg accgcgacta       240
     gttgccttcg gaaaatggga cctagccatg ccagatgagc gaggtcgtcg cttcccgcag       300
     tggcatgcgg actcgcctta ccaggaatgt gaggacttca ttgcagaact ggagcaagcg       360
     agaaaacgcg tcatgggtga tgagaaacat tactacctgg atacacttgg tactcatcct       420
     gattatcaac ggcgcggagc tggctctatg cttgtgcagt ggggctgcga cctggcggat       480
     aaggatggag ttgcggccta cgtggatgcc agcaaggagg gcgcatcact gtacttgaaa       540
     catggcttcg tgaatttcaa tccccccggt tcggatgtgg ctgcgatggc tcgccgtaag       600
     gcggctccga gctgttga                                                     618
//

If you have problems or comments...

PBIL Back to PBIL home page