(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_13.PE361

PENCW_13.PE361       Location/Qualifiers
FT   CDS_pept        818395..818739
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15947706"
FT                   /orf_name="Pc16g03610"
FT                   /product="Putative uncharacterized protein Pc16g03610 "
FT                   /protein_id="CAP93031.1"
FT                   /db_xref="UniParc:UPI000183116F"
FT                   /db_xref="UniProtKB/TrEMBL:B6H7S5"
FT                   /transl_table=1
FT                   /translation="MGNGWGMFPGEIWPRDENKTRLMVAGDMGMGFKGRVGQGHIKRKR
FT                   EETGADKRVAMGAWIYNSSNDKDTLKNAAYARGLAACRDEDFCFGPRQPHVSSYDALNH
FT                   DFPMEPGPQG"
     atgggaaatg ggtggggaat gtttcccggc gaaatatggc cccgggatga gaataaaacc        60
     cgcttaatgg tcgctggtga catggggatg ggtttcaagg gacgggtcgg gcaggggcac       120
     ataaaacgca agagagaaga gacgggggcc gataagagag tcgcaatggg tgcctggatt       180
     tacaattcct ccaacgacaa ggatacattg aaaaatgccg catatgcgag aggtctggcg       240
     gcttgcaggg atgaggattt ttgctttggc ccccgacagc cccatgtctc atcatacgat       300
     gcgctcaatc acgattttcc aatggaacca ggtccccagg gctga                       345
//

If you have problems or comments...

PBIL Back to PBIL home page