(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_13.PE362

PENCW_13.PE362       Location/Qualifiers
FT   CDS_pept        join(complement(819915..820181),complement(819614..819838),
FT                   complement(818882..819316))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15947707"
FT                   /orf_name="Pc16g03620"
FT                   /product="Pc16g03620 protein"
FT                   /protein_id="CAP93032.1"
FT                   /db_xref="UniParc:UPI0001831170"
FT                   /db_xref="UniProtKB/TrEMBL:B6H7S6"
FT                   /transl_table=1
FT                   /translation="MGTRFKDDTKDPAVNVTNWVLLVTIIFSVSARLGTKIRLFKRLTT
FT                   DDLLIIASLVFGIGQSIVVSLAVGSGYGKHFKDVSSADMQQVMKNLFAGSVLYLLSLTF
FT                   SKLSLVVFIRSLTPSAKDKWLARGVETIVYVWALVTIFGTAFQCSLPRTWDFQSGHCFN
FT                   LCDDRNNWRDRHPQEKHERQRSNISDVRNHHFRSDHAVPQYCDGLLGTTEPLPVLDAIE
FT                   RAQALWRGRPDFLELQDALAITRAVQVARSQEQIRKPRDLPSVYATRSNSGHAGLGGRQ
FT                   SVKPGAHNGVANTPLGYHELQVADHLS"
     atggggacac gattcaaaga tgacacgaaa gacccagcgg tcaatgtcac caattgggtc        60
     cttctagtca cgataatatt tagtgtctct gctcgactgg gaactaaaat tcgactgttc       120
     aaaagactca ctacagacga tctcctgatc attgcatctc tggtttttgg catcggtcag       180
     agcattgttg tttcgctggc agttggatct ggttacggaa agcattttaa agatgtctct       240
     agcgccgata tgcaacaggt gatgaaaaat ctttttgcgg ggtctgttct gtacctccta       300
     agcctcacgt tctcgaaatt atccctagtc gtgtttatcc ggagccttac accatccgcc       360
     aaagacaaat ggctcgcccg tggagtcgag accatcgtat atgtctgggc acttgttacc       420
     atctttggga ctgcgttcca atgctctctg ccccgtacct gggacttcca gagcggtcac       480
     tgctttaacc tctgtgacga tcgcaataat tggcgagatc gccatcctca agaaaagcac       540
     gaaaggcaac gatccaacat ttcagatgtg cgaaatcacc attttcgaag tgatcacgca       600
     gtgcctcagt attgtgacgg cctgttgggg acaactgagc cccttcctgt cttggatgcg       660
     atcgaacggg ctcaagctct atggcgtgga agacccgact tcttggagtt acaggatgcg       720
     ctcgcaatca caagggcggt ccaagtcgcg cgatcgcaag aacaaattcg aaaaccacga       780
     gaccttccct ctgtctatgc gacaagatcg aattctggtc acgcaggatt gggaggtcga       840
     cagtcagtca agccaggcgc acataatgga gttgcaaaca caccactagg ctatcatgag       900
     ttgcaagtcg ctgatcacct tagctag                                           927
//

If you have problems or comments...

PBIL Back to PBIL home page