(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_13.PE363

PENCW_13.PE363       Location/Qualifiers
FT   CDS_pept        join(821097..821207,821264..821334,821415..821558,
FT                   821616..821698,821761..822158,822220..822552,8
FT                   22606..823088)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000162166" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15947708"
FT                   /orf_name="Pc16g03630"
FT                   /product="Pc16g03630 protein"
FT                   /function="amino acid transmembrane transporter activity "
FT                   /cellular_component="membrane"
FT                   /protein_id="CAP93033.1"
FT                   /db_xref="GO:0015171"
FT                   /db_xref="GO:0016020"
FT                   /db_xref="InterPro:IPR002293"
FT                   /db_xref="InterPro:IPR004841"
FT                   /db_xref="UniParc:UPI0001831171"
FT                   /db_xref="UniProtKB/TrEMBL:B6H7S7"
FT                   /transl_table=1
FT                   /translation="MVAYEFKTTTSVTSRGGGPVDRDNAHLQRMGKRPVLKRNFGILSI
FT                   LGFSCTILGTWEGLLGVFPYPKPAVLQRSLTDISGGSGGAIYAYIFGWVGCFANFMVLS
FT                   ELASMAPTAGGQYHWAAMLAPGRLQKFLSFITGWFAVLGWQSAFAACAFLTGKMIQGAA
FT                   ILGNNLYNALPWEGTLIVWGSLSLALAVNLVGGNLLPRIEVIILVVHILGFFGIIIPLV
FT                   YMADHNTKEQAFLSFQNGGGFATQGLSWFVGMTSCAFAFAGGDAAVHMSEEVANASTVI
FT                   PNALMISVGINGCLGFGMIIVMMFCTDSDLGGKLGKITGYNFMGIFMEATDSVPGSLTM
FT                   ISIVIIIYVCSLMGLLAAASRQLWSFSRDRGVPGWRLWSQISSTRQLPIFAILLTVTVA
FT                   TLLSLINIGSNTAMEDIVSMAVAGIYLSYLMVSVLLFYRRVRGDISRYNDNEDDIVNVP
FT                   GAKLVWGPFHCPGIVGTVINGYAIIYLTIVVFFSFWPSTMDPTVETMNWSVLAIGGSSL
FT                   LAVIYYVVHARHIYKGPVMEVSL"
     atggtcgcct atgaattcaa gaccactacc tccgtcacca gcaggggcgg gggcccggtg        60
     gaccgtgata atgcgcatct ccagcggatg ggaaagaggc cagtccttaa gcgaaacttc       120
     ggcattctat cgatcctcgg cttcagctgt actattctag gtacttggga aggcctgctt       180
     ggtgtgtttc catatccaaa acctgctgtc ttgcaacgtt ctctaacaga tatcagcggc       240
     ggctccggcg gtgcgatata tgcctacata tttgggtggg ttggctgttt tgccaacttt       300
     atggtcttgt cggaattggc ctccatggcg cctaccgcag gaggccaata ccattgggct       360
     gccatgcttg cccccggcag actccagaag ttcctgagtt ttatcacagg atggtttgct       420
     gttctcggct ggcagagtgc attcgccgct tgtgcctttc tgacggggaa gatgatccag       480
     ggtgccgcga tcttaggaaa caacctttac aacgctctgc cttgggaagg cacgttgatt       540
     gtctggggtt cgctcagtct cgcattggcc gtgaatctgg tcggcggcaa cttgctgccc       600
     cgcattgagg tgatcatttt ggttgtgcat attcttggat tctttggcat tatcatcccc       660
     ctggtctata tggcagatca taacaccaag gagcaggctt ttctgtcttt ccagaatgga       720
     ggaggctttg ccacacaagg actatcctgg ttcgttggta tgaccagctg cgcctttgcc       780
     tttgctggag gtgacgccgc cgtgcatatg tctgaagagg tcgctaatgc ctcgaccgtt       840
     atccctaacg ccctcatgat tagtgtcgga atcaatggct gcctcggctt cggcatgata       900
     attgttatga tgttttgcac cgactctgac ctgggtggta agctggggaa aatcactggg       960
     tacaacttta tgggtatctt catggaagca acagactcag taccaggatc attgaccatg      1020
     atctctattg tgatcattat atacgtctgc tccctaatgg gtctactggc tgcggcatcc      1080
     cggcagcttt ggtctttctc tcgagatagg ggagtaccgg gatggcgatt gtggagtcag      1140
     atttcttcca caagacagtt gcccattttc gccatccttc ttacagtgac cgtcgctaca      1200
     ttgctttccc taattaacat tggctccaac accgcgatgg aggatatcgt ctccatggca      1260
     gtggcgggta tctacctctc ctacctcatg gtttctgttt tgctctttta ccgccgcgtc      1320
     cgtggcgaca tctcccgata taatgacaac gaggatgaca ttgtcaacgt gcctggtgcg      1380
     aagcttgttt ggggaccctt ccattgcccc ggcattgttg gcaccgtgat aaacgggtat      1440
     gcaattatct acctcaccat cgtcgtcttt ttcagtttct ggccaagtac aatggaccca      1500
     actgtggaaa cgatgaactg gagtgttctg gcaattggag gcagcagttt gctcgccgtt      1560
     atatactacg ttgtacacgc ccggcacatc tacaagggtc ctgttatgga agtatcgttg      1620
     tag                                                                    1623
//

If you have problems or comments...

PBIL Back to PBIL home page