(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_13.PE364

PENCW_13.PE364       Location/Qualifiers
FT   CDS_pept        join(complement(824584..824783),complement(824502..824530),
FT                   complement(824323..824449),complement(824138..824265),
FT                   complement(823977..824077))
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000169930" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20671661"
FT                   /orf_name="Pc16g03640"
FT                   /product="Pc16g03640 protein"
FT                   /protein_id="CAP93034.1"
FT                   /db_xref="UniParc:UPI0001831172"
FT                   /db_xref="UniProtKB/TrEMBL:B6H7S8"
FT                   /transl_table=1
FT                   /translation="MQLLSLFTSLALVSAVVSSPAADLNVNVARADDQHGSYIVSGLGA
FT                   RKQEILKAGGNTRDMAIAMLETDNMTTDYKYGDGKTGDGTNFGVFKQNWFILRNSAADF
FT                   LGQTVDQVDNGVILNTDLAKDIKARHEGEAKYGYEKWFSGHRNGETGLKNPGTDDIKTY
FT                   MSGVAWIQQQLESDEKYQSDDTRFYVQVVAI"
     atgcagctcc tctctctttt cacctctttg gctctcgtgt ctgccgtggt ctcgtctcct        60
     gcagcagact tgaacgtgaa cgttgcccgc gcagacgatc agcatggcag ctacattgtt       120
     tctggcctcg gagcacgcaa gcaggagatc ctgaaggccg gtggtaatac tcgtgacatg       180
     gccattgcca tgctggagac cgacaacatg accaccgatt acaaatacgg tgacggaaag       240
     accggcgacg gcaccaactt cggcgtgttc aagcagaact ggttcatcct gagaaattct       300
     gccgctgact tcctgggtca gaccgttgac caagtcgaca acggtgttat cctcaacacc       360
     gatctagcca aggacatcaa ggctcgtcac gagggcgagg ctaagtacgg ttatgagaag       420
     tggttcagtg gccaccgcaa cggagagact ggtctcaaaa accctggcac tgatgacatc       480
     aagacctaca tgagtggtgt tgcatggatt cagcagcagc ttgagagtga tgaaaagtac       540
     cagagcgacg atactcgatt ctacgttcag gtcgtggcta tctag                       585
//

If you have problems or comments...

PBIL Back to PBIL home page