(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_13.PE365

PENCW_13.PE365       Location/Qualifiers
FT   CDS_pept        join(complement(828058..828241),complement(827690..827995),
FT                   complement(826805..827637),complement(826476..826751))
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000202868" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15947709"
FT                   /orf_name="Pc16g03650"
FT                   /product="Pc16g03650 protein"
FT                   /function="substrate-specific transmembrane transporter
FT                   activity"
FT                   /cellular_component="integral to membrane"
FT                   /protein_id="CAP93035.1"
FT                   /db_xref="GO:0016021"
FT                   /db_xref="GO:0022891"
FT                   /db_xref="InterPro:IPR003663"
FT                   /db_xref="InterPro:IPR005828"
FT                   /db_xref="InterPro:IPR005829"
FT                   /db_xref="InterPro:IPR016196"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="UniParc:UPI0001831173"
FT                   /db_xref="UniProtKB/TrEMBL:B6H7S9"
FT                   /transl_table=1
FT                   /translation="MSLDKEEKQLEDISKDNVEQIEHAEHFDLKDQSDLSSIEATAASK
FT                   TAWLICIVVSIGGLLFGYDTGYISAVLVTIGSSLGHVLSSSEQEMVTSLTSGGALVGAV
FT                   GAGLTADRFGRRLPIWGACVVFVIGTALQTAAFSVGQFATGRFVVGLGVGSASMIVPLY
FT                   IGELAPAQYRGRMVAFNNMSVTFGQFLASALGAGFAEAKGEAWRATVGLGAAPALALAG
FT                   LLFVCPESPRQLVTHGKREAAEAVLLRIYPTSTVGQRQAKIRSIELSLQEVSMDKESLW
FT                   VTFKRIFTTPSTGRAVLTACMIMAISQLGGFNTLMYYAATLFSIVGFSNATAVGITVSG
FT                   TNFVFSILNLLLVDKFGRRIILTITVLGMSLCMIVAVIAFRYIPIDTETLVVESNNIGW
FT                   PGILVLVAIICYVACYSSGVATIAWIGTELIPLEVRAMGTMLNTVTCWSTNIIISSTFL
FT                   SMMKAWTPSGAFGFYAGICFFGWVFVVFFYPECKGMPLEAVREVFSTGFGVRYSKKWQK
FT                   DHKDDVKVQTIVLGH"
     atgagccttg acaaagaaga aaagcaattg gaggatatat ccaaggataa cgtcgagcag        60
     atagagcatg ccgaacattt cgatctcaaa gaccagtccg atctcagcag cattgaggca       120
     acagctgcct ccaagacagc ttggttgatc tgcattgtcg tctccatcgg tggtctctta       180
     tttggctacg acacgggcta catctccgcc gttctagtca caatcggatc atctctcggc       240
     catgtcctta gctcgagtga acaggaaatg gtgacctctc tcacaagtgg cggcgctctg       300
     gtcggtgcag taggagctgg tctcaccgcc gatcgatttg gtcgtcgcct acccatctgg       360
     ggagcctgcg tggttttcgt gatcggaact gcgctccaaa cagccgcctt ttctgttggc       420
     caattcgcga ccggaagatt cgttgtgggc cttggggtag gaagcgcatc tatgatcgtt       480
     cctctctata ttggtgagct ggcacctgcg caataccgcg gccgcatggt tgccttcaac       540
     aacatgagtg tcacattcgg tcaattcctt gcgagtgccc tgggtgcggg ctttgctgag       600
     gcaaaaggtg aggcgtggcg agcaactgtc ggtctcggag ctgctccagc tcttgcactg       660
     gccgggttac tgtttgtctg tccagaatca cctcgacagc tggtcactca tggcaaacgg       720
     gaggcagcgg aagctgttct tctacggata tacccaacgt cgactgttgg acaacggcaa       780
     gctaaaatta gatcaatcga gttatccctt caagaagtat ccatggacaa ggaatccctt       840
     tgggtcactt tcaaacgcat cttcaccaca ccctcgaccg gccgtgcagt tctaaccgcc       900
     tgtatgatca tggcgattag tcaacttgga ggttttaaca ccctgatgta ctatgccgca       960
     acgctatttt ccattgtcgg attcagcaat gccacagccg tcggtatcac agtctccggt      1020
     acgaatttcg tcttctcaat tctcaatctc ctactcgtgg ataagttcgg ccgtcggatt      1080
     atcctgacaa tcaccgtcct tggaatgtct ctctgcatga tcgtcgctgt catcgcgttc      1140
     cgatatatcc caatagatac cgagactctg gttgtggaga gtaacaacat cggctggcca      1200
     ggcatcctgg tcctcgtcgc aattatctgc tacgtcgctt gctattcatc cggtgtcgcc      1260
     actattgcat ggatcggcac tgagctaatt cctctcgaag tgcgagcaat gggcactatg      1320
     ctaaacaccg ttacatgctg gagcacgaat atcatcattt catctacctt cctttcgatg      1380
     atgaaggctt ggaccccaag tggtgctttt gggttttacg ctggaatctg cttcttcggt      1440
     tgggttttcg tagtcttctt ctaccccgag tgtaaaggga tgccattgga ggctgtccga      1500
     gaagtcttca gcaccggatt cggggtcagg tattcaaaga agtggcagaa ggaccacaaa      1560
     gatgatgtca aggtgcaaac aattgtcttg ggacattag                             1599
//

If you have problems or comments...

PBIL Back to PBIL home page