(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_13.PE366

PENCW_13.PE366       Location/Qualifiers
FT   CDS_pept        join(829700..829947,830003..830340,830400..830719,
FT                   830775..831015,831075..831265)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000158981" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15947710"
FT                   /orf_name="Pc16g03660"
FT                   /product="Pc16g03660 protein"
FT                   /function="ATP binding"
FT                   /function="protein serine/threonine kinase activity "
FT                   /biological_process="protein phosphorylation"
FT                   /protein_id="CAP93036.1"
FT                   /db_xref="GO:0004674"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0006468"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR008271"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR017441"
FT                   /db_xref="InterPro:IPR017442"
FT                   /db_xref="UniParc:UPI0001831174"
FT                   /db_xref="UniProtKB/TrEMBL:B6H7T0"
FT                   /transl_table=1
FT                   /translation="MNTIRPSIPRLSALLRKKPFPTPSPGPPLLPGILIDEEISPVYDS
FT                   KYFYPAKPGEVLADRYQILVKVGWGVSSTVWLARDLQGHFEESESVVALKIANSNASSA
FT                   GHEREVEEHISTADPSHRGRSLIRTLLDSFEIKGSEGSYSCLVYPPMREPLSMYQRRFG
FT                   DRKMPLPLIKTYIRALLTGLDYLHQKCRIVHTDLKLENIMVSFEDATVLADFMDSQLER
FT                   PMAFKIDSTGRPVYQSRSDFGPLKSLSSIPQLVDFGLATRLEEDDDWGVWPIQPDHYRA
FT                   PEVILGNGWQMPADIWNLGVLLWDMIEGKELFQHIHDQQGRYDAKLHIAEMIALLGPPH
FT                   PEVIQRYQFMREYSWPQPVRREDGRLCETAEEYFGGPFFDNNGRFLYEDMIPDWKLGDT
FT                   VSFLEGEEREAFLDLAKQMLVWHPNIRKTAGQLAGHPFLQLKQTSV"
     atgaacacta taaggccgtc cattcctcgg ttgtctgcct tgcttcgcaa gaaacccttt        60
     cccacccctt ctcccgggcc acctttactg cccggcatac tcattgatga agagatctcg       120
     ccagtatatg attccaagta cttctaccca gcgaagcctg gagaggtact cgccgatcgt       180
     taccaaatac tggtaaaggt tggttggggc gtgtcttcaa cagtatggct cgcgcgtgat       240
     ttacaagggc acttcgaaga gtcagagagc gttgtagcac taaaaattgc caatagcaat       300
     gcgagttctg ctggtcatga gcgcgaggtt gaagagcaca tttccacagc agacccatca       360
     caccgcggtc gctcactcat ccgaacattg ctagactctt ttgaaatcaa aggttcagaa       420
     ggttcttact catgtcttgt gtatccgcct atgagagagc ctttgtcgat gtatcaacgg       480
     cgctttggtg atagaaagat gccgctaccc ctcatcaaaa catacattcg tgctcttctt       540
     acggggcttg attatcttca ccaaaaatgc aggatcgttc atacggatct aaagcttgaa       600
     aacatcatgg tctcattcga ggatgcaacc gtgcttgctg atttcatgga ttctcagctt       660
     gaaagaccga tggctttcaa gattgattca acggggcgac cagtgtacca gtcccgtagt       720
     gacttcggac cactcaaaag cctgagtagt ataccacagc ttgtcgactt tggcttagca       780
     actcgcctcg aggaagatga cgactggggc gtctggccta ttcagccaga ccactatcgg       840
     gccccggagg tgatactagg taatggatgg caaatgcctg cggatatttg gaatcttggt       900
     gttctgttgt gggatatgat cgaaggcaaa gagctatttc agcatatcca cgatcaacaa       960
     ggtcgctacg atgctaaatt acacatcgcc gaaatgatag ccttactcgg tccaccccat      1020
     ccagaggtca tccaaaggta tcaattcatg cgagagtact cgtggccgca acctgtcaga      1080
     cgagaagacg gtagactatg cgagactgca gaggagtact tcggtgggcc atttttcgac      1140
     aataatggtc gctttctcta tgaagacatg atccccgact ggaaactagg agacactgtt      1200
     tccttccttg agggagagga gagggaagcg tttctggacc tcgccaagca gatgcttgtc      1260
     tggcatccaa atataagaaa aacagcaggc caactagcgg ggcatccttt tcttcaacta      1320
     aagcaaacaa gcgtctga                                                    1338
//

If you have problems or comments...

PBIL Back to PBIL home page