(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_13.PE367

PENCW_13.PE367       Location/Qualifiers
FT   CDS_pept        complement(831736..833853)
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000214384" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18128688"
FT                   /orf_name="Pc16g03670"
FT                   /product="Pc16g03670 protein"
FT                   /function="ammonia-lyase activity"
FT                   /biological_process="L-phenylalanine catabolic process "
FT                   /biological_process="biosynthetic process"
FT                   /cellular_component="cytoplasm"
FT                   /protein_id="CAP93037.1"
FT                   /db_xref="GO:0005737"
FT                   /db_xref="GO:0006559"
FT                   /db_xref="GO:0009058"
FT                   /db_xref="GO:0016841"
FT                   /db_xref="InterPro:IPR001106"
FT                   /db_xref="InterPro:IPR005922"
FT                   /db_xref="InterPro:IPR008948"
FT                   /db_xref="UniParc:UPI0001831249"
FT                   /db_xref="UniProtKB/TrEMBL:B6H7T1"
FT                   /transl_table=1
FT                   /translation="MTLKRHSQSAHMNATLQLLGRVRDLKNKKRSIVLNGNDLDIASTV
FT                   AVARHGVEPTISTDECLAKRLEISVDTLADVISRKCVIYGVNTGFGGSADTRTNELIDL
FT                   QTHLLQFIQSGIITTADKDPASNSEREPSHVMPLAWVRAAIVARTNQNLRGHSAIRKCV
FT                   LKSLIDLLHNDITPLIPLRGTISASGDLMPMAYIAGAIMGNPDVFVQVGKGAQAIVMPS
FT                   SEALKMSGLSPSGLGPKEGLGLINGTAPSAALASLALYNTQQLALLSQMLTAFASECLA
FT                   GNVEWAHPFVHATRPHAGQIEVASNIRRFLKGSKFVVGLESQEASGDGLCQDRYSTRTA
FT                   PQWIGPYIEDLLLAQHQLEVELNSTSDNPLVDTSKQEDGSSGKVYSGGNFQAAAVTSAM
FT                   DKARLAIQMIGRMLWSQVTEMINPATNNGLEANLNATAQENFTMKGIDINMSAYMSELA
FT                   ALVHPVSAHVMSAEMHNQGINSLALISARRTMEAADLLAHMSACHIYVSCQGVEIRANH
FT                   LRFLSTLRTKMKDFTANGALYGLGLDDSQLETLCTSLLPIVQSSWYRANSNTWKDRVLS
FT                   VVDAVALAVNEFVASHSPDCSVSTMMAFKKRFHGLVSSTAEQMFYPGPTISPEEVAMQL
FT                   GGGTAQIYTWVRSNLNIPMNRGLQDDPLFNAQKGLPTKGKRSIGSSVSMVYESLIKGEM
FT                   MDVILEGWTQD"
     atgaccctaa agaggcacag ccaatcggct catatgaacg caacgctcca actgctgggg        60
     cgcgtacgtg acttgaagaa caagaagcga agcattgttc tcaacggcaa cgacctcgac       120
     attgcctcca cagtcgccgt cgcccgtcat ggagtcgagc ccactatcag cacggacgag       180
     tgtctcgcca agcgactcga gatctccgtc gacactctag ccgatgtcat ctcccggaag       240
     tgtgtcatct acggcgtcaa cactggtttc ggtggcagtg ccgatactag aaccaacgaa       300
     ctcatcgacc tgcagactca tctgctccaa tttatccaaa gtggaattat cacgacggct       360
     gacaaggatc cggccagcaa ctcggagcgg gaaccatccc acgtgatgcc tctcgcctgg       420
     gttcgagccg ccatcgtggc ccgtaccaat cagaacctta ggggtcacag tgccatccgc       480
     aagtgcgtgc tcaagagcct tattgaccta ctgcacaacg acattacacc tctaattcct       540
     cttcggggga ccatttctgc atctggagat cttatgccca tggcatatat tgctggagca       600
     atcatgggca acccagatgt ctttgttcag gtgggtaagg gtgcgcaagc catagttatg       660
     ccttcgtctg aggccttgaa gatgagcggg ctctccccgt caggcctcgg cccaaaggag       720
     ggacttgggc taatcaacgg cactgctcct tctgcggcat tggcaagctt ggcattgtat       780
     aatacgcagc agcttgcgtt gttgtctcaa atgttgacgg cttttgcgtc cgagtgcttg       840
     gccggaaatg tagagtgggc tcatcccttt gttcacgcga ctcgacctca cgctgggcaa       900
     atcgaggtgg caagcaatat ccggcgcttc ttgaagggtt ccaagtttgt tgttggccta       960
     gagtcgcagg aggcatctgg cgacgggctc tgccaagatc ggtattcaac aagaacagct      1020
     cctcagtgga ttggaccgta catcgaggac cttctcttgg cacaacatca gctcgaggtg      1080
     gagctcaact ccacatcaga taaccctctg gtggatacga gcaaacaaga ggatggttcg      1140
     agcgggaaag tgtactctgg tggaaatttc caagcagctg ccgtcacgtc cgctatggat      1200
     aaggctcgct tggccattca gatgatagga cgaatgcttt ggtcccaagt tactgagatg      1260
     attaaccctg ctacgaataa tggactcgag gccaacctta atgccaccgc gcaagagaac      1320
     ttcaccatga agggaatcga catcaacatg tcagcgtaca tgtctgagtt agcagccctg      1380
     gtacacccgg tctccgccca cgtcatgtca gccgagatgc ataatcaggg tatcaactct      1440
     ctcgctctga tttcagctcg acgcactatg gaggctgcag atctgttggc gcacatgagt      1500
     gcctgtcaca tatatgtctc atgccagggt gttgagatcc gagcaaacca cctccgattc      1560
     ctttcaacgc tgcgcacaaa gatgaaggat ttcaccgcaa acggagcctt gtatggactc      1620
     ggattggatg actcacaact tgagacacta tgcacgtcac tcctccccat tgtgcagtca      1680
     agctggtatc gtgcaaactc caatacttgg aaagaccgtg tcttgtctgt cgttgatgct      1740
     gttgcgttgg cagtcaatga attcgtggcc tctcacagcc ccgattgttc agtgtcaacg      1800
     atgatggcct ttaagaagcg ttttcacggc cttgtgtcca gtacagcgga gcaaatgttt      1860
     tatcctggtc cgaccatttc tcccgaggag gtggcgatgc agcttggtgg ggggactgca      1920
     caaatatata cctgggttcg ctcgaacctg aatatcccta tgaaccgtgg cctccaagac      1980
     gatcctttat tcaacgccca gaaaggcctt cccacaaagg gcaaaaggag cataggaagc      2040
     tcggtgagca tggtgtatga gagcttgatt aagggcgaga tgatggatgt gattttagag      2100
     ggctggacgc aggactag                                                    2118
//

If you have problems or comments...

PBIL Back to PBIL home page