(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_13.PE371

PENCW_13.PE371       Location/Qualifiers
FT   CDS_pept        join(complement(842024..842547),complement(841895..841969),
FT                   complement(841684..841846))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000076659" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20671664"
FT                   /orf_name="Pc16g03710"
FT                   /product="Pc16g03710 protein"
FT                   /protein_id="CAP93041.1"
FT                   /db_xref="UniParc:UPI000183124D"
FT                   /db_xref="UniProtKB/TrEMBL:B6H7T6"
FT                   /transl_table=1
FT                   /translation="MSSLESPTRPESPVDVVDVGPSRWAIVSKLQERTNILSQQDVTDG
FT                   LGPAYVTEKFLCSSLDSSNTPAFMRVYKQVPIAGTEIKKASVRAAQAVKSYEPIELVAL
FT                   KSLQEKGCDVIPRLLAYQCDEQAEDDTVPGGFIAYVIWEKVPGESLNTQKFWGYSLSER
FT                   EEIRLKFREAYKAVQACGYGLFPGIKKIIYHRPTQTIYLSGFSGPYRTEDTQWSDDIYC
FT                   AYGLVRPPTALDQIFPITSTDLKYDDKGWRW"
     atgtcatcac ttgaatcgcc cacccgtcca gaatcgcccg tggatgttgt tgacgttggc        60
     ccttcgagat gggcaatcgt cagcaaacta caggagcgca ctaatattct gagtcagcaa       120
     gatgtcaccg atggccttgg cccagcatac gtgactgaga agttcctttg ttcctctctt       180
     gactctagca atacacctgc ttttatgcga gtgtataagc aagtacctat tgccggcaca       240
     gagattaaga aggcttcagt ccgggccgca caggctgtca agtcctacga gcctatagag       300
     cttgtcgctc tcaagtccct ccaagagaag ggctgcgatg ttattcctcg actcctcgca       360
     tatcagtgtg acgaacaagc tgaagacgat acagtgcccg gtgggtttat cgcatatgtg       420
     atatgggaga aggtgccagg cgagtccctc aatacgcaga agttctgggg ttactcgtta       480
     tcggagcgag aagagatccg gctcaagttc cgcgaggcct acaaggcggt tcaggcttgc       540
     ggatacggtc tatttcctgg gataaagaag atcatatatc ataggcctac tcaaacgatc       600
     tatctatcgg gattctctgg cccgtaccgt accgaagaca cccagtggtc cgatgacatt       660
     tactgcgctt atggtctcgt tcggccacct acagcactgg accagatctt tcccattacc       720
     agcactgatt tgaagtatga cgacaagggt tggagatggt ag                          762
//

If you have problems or comments...

PBIL Back to PBIL home page