(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_13.PE372

PENCW_13.PE372       Location/Qualifiers
FT   CDS_pept        join(842863..843022,843107..843179,843256..843333,
FT                   843379..843498,843634..843799)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18977574"
FT                   /orf_name="Pc16g03720"
FT                   /product="Putative uncharacterized protein Pc16g03720 "
FT                   /protein_id="CAP93042.1"
FT                   /db_xref="UniParc:UPI000183124E"
FT                   /db_xref="UniProtKB/TrEMBL:B6H7T7"
FT                   /transl_table=1
FT                   /translation="MGIFEDHDSSLRLGTFGSFAEVIGGVNTRPNSLSECDLQGVDGGL
FT                   RRPAAPAAVLLEVMIPLAALRSSLFDIWVQVRGDARQQARAGRNYTALLVRSTDSYHMR
FT                   GHCSSGNCRTTAGRLLPQSESGLIRHLRRGYRYARRVACQGQGSNRTPQRFPRESLEET
FT                   VGPRRGEVGLNALVTEEGDAIVSFSVDSECSDLVA"
     atggggattt ttgaagacca tgatagctcc ttgcggctcg gcacatttgg ctccttcgcc        60
     gaagtcattg gcggcgtaaa taccaggccg aactcgttgt cagaatgtga cctccaaggt       120
     gttgatggag ggctgagacg accggccgcg ccagctgcgg tattgctcga agtgatgata       180
     ccacttgctg cacttcgtag ctctcttttt gatatctggg ttcaagtccg aggggatgct       240
     cggcaacaag cgagagctgg tagaaattac accgctctgc ttgtccgttc cactgacagt       300
     taccacatgc ggggccattg ttcttcaggc aattgtcgca ctactgctgg gagacttctc       360
     ccacaatctg aatcaggatt gattcgacat ttgcggcgcg gctaccgata cgctcgtcga       420
     gtcgcttgcc agggccaggg ttcaaatcgg accccccagc ggttcccacg ggaatctcta       480
     gaggagacag taggtccccg ccggggggaa gtaggattga acgcgcttgt tactgaggaa       540
     ggcgatgcta ttgtttcgtt ctccgttgat tcggaatgca gtgacctagt ggcatga          597
//

If you have problems or comments...

PBIL Back to PBIL home page