(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_13.PE374

PENCW_13.PE374       Location/Qualifiers
FT   CDS_pept        join(845730..845738,846076..846390)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000000000" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15947711"
FT                   /orf_name="Pc16g03740"
FT                   /product="Pc16g03740 protein"
FT                   /protein_id="CAP93044.1"
FT                   /db_xref="UniParc:UPI000183124F"
FT                   /db_xref="UniProtKB/TrEMBL:B6H7T8"
FT                   /transl_table=1
FT                   /translation="MQMSAISTGINNAGSLLGYHYIPGGAEECDGCPAYNNQICKSAAA
FT                   GAAPIQSPWGPIISSRRTLYLSHIVRIDSTEKATGTIRYRSSYLANRSPTALIEAKSQK
FT                   EGY"
     atgcagatgt cagcgatatc gactggaata aacaacgccg gttccctctt gggataccac        60
     tacatccctg gtggtgcaga agaatgcgat gggtgtccgg catacaacaa ccagatatgc       120
     aagtctgctg cagcaggtgc cgctcccatc caatctccgt ggggtcccat aatctctagt       180
     aggcgaactc tttacctgtc ccacattgta cgaattgaca gcacggagaa agcaactggg       240
     actattcgtt atcgttcaag ctatttggcc aaccgcagcc cgacagcgct catagaagcc       300
     aaatctcaaa aggaaggata ttga                                              324
//

If you have problems or comments...

PBIL Back to PBIL home page