(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_13.PE375

PENCW_13.PE375       Location/Qualifiers
FT   CDS_pept        join(complement(847752..848317),complement(846616..847687))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000237402" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15947712"
FT                   /orf_name="Pc16g03750"
FT                   /product="Pc16g03750 protein"
FT                   /protein_id="CAP93045.1"
FT                   /db_xref="InterPro:IPR010354"
FT                   /db_xref="UniParc:UPI0001831250"
FT                   /db_xref="UniProtKB/TrEMBL:B6H7T9"
FT                   /transl_table=1
FT                   /translation="MEKTKKARIRGKRDPKQTEAWILGTGTASLASAFYLIKHAKAPPR
FT                   KVHILESCDSLQEIWHHKGDPTSGYDQFAGCLPVPIGEPLKELLSCIPSAFPTTSRRAS
FT                   FLHAIQSAEVNRTFATQVNNTCIVVQKDGKLQNIVTSSLDLNFKQRLNLVRFMLKGEGR
FT                   LGRNHISDFFPQNFFETSFWAIWSAQFGLQPWHSATEFRRALRHYLGDFHNLSILNCLD
FT                   ITGYYQFESIFLPICLFLESLDVDFQFDTKVRAIVTTSNNDTRTISRLELSQNGFLTHK
FT                   DLGPHDIVIATLGSTESGAAVGSNDHQPVMLSFDACDQFDENWSLWLTLAPIGRDFGNP
FT                   YAFCTRRPQSMVESFTITTKEVNFFNYLTSLSQSTLATGALIVLRESRWKLNLCIPAQP
FT                   VFQYQPEDVRVLWGFAIFPEGIGDYVKKPMLQCSGAEIMTELLKHLNYPSELVFRHTVN
FT                   IPRVMPRMSAIILAHSRDERPEVVPRNTSNIGLVGQFVEIPQYSCIDMSYAARSAQMVV
FT                   SRLMGIDIPSAEVKRSLTALLIRILLWK"
     atggagaaga caaagaaagc ccgaattcga ggcaaacgcg atcctaagca aactgaggcc        60
     tggattcttg gaacagggac cgcatcgttg gcgtccgcgt tttatctgat caagcatgcc       120
     aaagcaccgc ctcggaaggt gcatattctc gagtcgtgtg attccttgca ggaaatctgg       180
     catcataaag gcgacccaac cagcggatac gatcagtttg caggatgctt gcctgttcca       240
     atcggtgaac ctctgaaaga actcctttct tgtatcccat ccgctttccc cacaacaagc       300
     cgtcgggcga gctttttgca cgccatacag tcagcagaag tcaaccgaac ctttgcaacg       360
     caagttaata acacatgtat cgtggtacaa aaggatggca agctccagaa tatcgtgact       420
     agctcgctgg acttgaattt caagcagcga ttgaatcttg ttcggtttat gctgaaagga       480
     gaagggcggt tgggaagaaa tcatatcagt gacttctttc cacaaaactt tttcgaaact       540
     tcgttttggg ctatctggtc cgctcaattc ggtcttcagc cttggcacag cgcaactgag       600
     ttcaggcgtg ctttgcgtca ctacctcggt gatttccaca acctatctat tttgaactgc       660
     cttgatatta ccggttacta ccaatttgag tccatattcc ttcctatctg ccttttcctc       720
     gagagccttg atgtggattt tcagttcgat accaaggtta gggccattgt gactacctct       780
     aataatgata ctcgaactat ttcacgacta gagttgagtc agaatggttt cctaacccac       840
     aaggaccttg ggccccacga catcgttata gcaaccctag gatctacaga atcaggggct       900
     gcggtcggat cgaatgatca tcaaccggtt atgttatcat tcgatgcgtg cgatcagttt       960
     gacgagaact ggtcactatg gctcaccctt gcccctatag gcagagattt cggcaatccc      1020
     tatgctttct gcacacgtcg gcctcagtca atggtagagt ccttcacaat cactaccaaa      1080
     gaggtcaact ttttcaacta tctcacttct ctgtcacaat cgacgttagc aacaggggca      1140
     ttgatcgttc ttcgggagag tcggtggaaa cttaatctct gtatacccgc gcaaccagtc      1200
     tttcaatatc agccagaaga cgtgcgcgtt ctttgggggt tcgcaatctt cccggagggt      1260
     ataggtgact acgttaagaa accgatgcta caatgctcgg gtgcagagat tatgacggaa      1320
     ctccttaaac atctaaatta tccatctgag ctggtctttc gacacacggt caatattcca      1380
     cgcgttatgc cacggatgag tgcaatcatt ctagctcatt cgcgggatga acgtcccgag      1440
     gttgttcccc ggaacacctc gaacattgga ctggttgggc aattcgtcga gataccacaa      1500
     tacagctgta ttgacatgag ttatgctgct cgttcggcgc aaatggtggt atccaggctg      1560
     atgggtatcg acataccgtc ggccgaagtg aagaggtcac taactgcact tttgatacgg      1620
     atcctactct ggaaatga                                                    1638
//

If you have problems or comments...

PBIL Back to PBIL home page