(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_13.PE377

PENCW_13.PE377       Location/Qualifiers
FT   CDS_pept        851671..852510
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000219622" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19824344"
FT                   /orf_name="Pc16g03770"
FT                   /product="Pc16g03770 protein"
FT                   /protein_id="CAP93047.1"
FT                   /db_xref="InterPro:IPR008579"
FT                   /db_xref="InterPro:IPR011051"
FT                   /db_xref="InterPro:IPR013096"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="InterPro:IPR017627"
FT                   /db_xref="UniParc:UPI0001831251"
FT                   /db_xref="UniProtKB/TrEMBL:B6H7U0"
FT                   /transl_table=1
FT                   /translation="MGNDQKLGAYYAPKGGLPPQTQILTDRAMFTEAYAVIPKGTFSDI
FT                   VTSFLPFWDKTRLWVIARPLSGFAETFSQYIMEVQPGGGSDRGETDDSAQGVVFVVEGE
FT                   VTITLGSQKHTLAEGGYAYLPPKSGWTLRNTGATTARFHWIRKAYEYVEGLDKPEPLFL
FT                   NEKDIPPTPMPNTNGAWATTRFVDPSDLRHDMHVTIVTFEPGGLIPFAETHVMEHGLYV
FT                   LEGKAVYRLNQDWVEVEAGDFMWLRAFCPQACYAGGPGKFRYLLYKDVNRQMKLSRL"
     atgggtaacg accagaagct cggtgcctac tatgcaccca aaggcggatt gccaccacaa        60
     acacagatcc tcaccgaccg tgccatgttc accgaagcat acgcggtaat cccgaagggc       120
     acattcagcg acatcgtgac gagcttcctg cccttctggg acaagacacg gttatgggtg       180
     attgcccgtc cgttatcggg ctttgccgaa acattttcgc aatacatcat ggaagtgcaa       240
     ccggggggcg gcagcgaccg cggcgaaaca gacgacagtg cacaaggtgt cgtgtttgtc       300
     gtcgagggcg aagtgacaat taccctggga agccagaaac acacacttgc cgagggcggc       360
     tatgcctatc taccaccgaa gagcggctgg accctgcgca acacaggcgc gaccaccgcc       420
     cgtttccatt ggatacgcaa ggcctacgaa tatgtcgagg gactcgataa gcctgagccg       480
     cttttcctca atgaaaagga tattccgccc acgcccatgc cgaacaccaa tggtgcttgg       540
     gcgactactc gattcgttga cccgagcgat ctgcgccacg atatgcatgt caccattgtt       600
     accttcgagc ccggcggtct tatccccttc gctgaaactc atgtcatgga acatgggctt       660
     tatgtactag aaggtaaagc cgtgtacagg ctcaatcagg actgggtgga ggtggaagcg       720
     ggtgatttca tgtggttgcg cgccttttgt ccgcaggcct gttacgcggg tggccctggc       780
     aaattccgct acctgctcta caaggacgtg aaccgtcaga tgaagttgtc gcggctgtag       840
//

If you have problems or comments...

PBIL Back to PBIL home page