(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_13.PE378

PENCW_13.PE378       Location/Qualifiers
FT   CDS_pept        join(complement(854037..854145),complement(853030..853970))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000294684" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15947713"
FT                   /orf_name="Pc16g03780"
FT                   /product="Pc16g03780 protein"
FT                   /function="oxidoreductase activity"
FT                   /function="zinc ion binding"
FT                   /biological_process="oxidation-reduction process "
FT                   /protein_id="CAP93048.1"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="GO:0016491"
FT                   /db_xref="GO:0055114"
FT                   /db_xref="InterPro:IPR002085"
FT                   /db_xref="InterPro:IPR011032"
FT                   /db_xref="InterPro:IPR013149"
FT                   /db_xref="InterPro:IPR013154"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="UniParc:UPI0001831252"
FT                   /db_xref="UniProtKB/TrEMBL:B6H7Y7"
FT                   /transl_table=1
FT                   /translation="MATQSAIVVQGPGRATLEDVPLPEVPDDYILVKTKAVALNPTDWR
FT                   HIDFVPCTGATVGCDYSGIVEAVGPRVKKAFKKGDRVAGFVHGSNAVRNNGGAFAQYVI
FT                   AKGDLQILIPESMSFEAAATFGVGLTTVGQNLYQSMELPFPGNQDSESDDTNILIYGGA
FT                   TATGTLAIQLAKLSGLRVVTTCSEANRSFMFELGADAVFDYHDPLVGEQIREDTDDALE
FT                   FVLDTISTPQSAAICSAAISSAGGSYNALLDVASARDDVDSHVSMAYDVLGEPYRMGTN
FT                   ERAPDSTNFEFGVKWWGLAQKLIEERRIHPHPYQVKPGGLAGALAGLQILREGKVRASK
FT                   LVYRVDESE"
     atggccaccc aaagcgccat tgtcgtccaa ggaccaggcc gcgcgacgct ggaagatgtc        60
     cccctccccg aggtaccgga tgactatatt ctcgtcaaaa caaaagcagt cgccttgaat       120
     ccaacggact ggcgtcatat tgattttgta ccctgtacag gggccaccgt gggctgcgac       180
     tattctggaa tagtagaagc cgtggggcca cgcgtcaaaa aggcattcaa aaaaggcgac       240
     cgagtagccg ggttcgtaca cggcagcaac gccgttcgta acaatggcgg cgcctttgct       300
     cagtacgtga ttgcgaaggg cgatctccaa atattgatac ccgagtccat gagcttcgaa       360
     gcggcagcca cctttggcgt tggtttgaca accgttggtc agaatcttta ccagagcatg       420
     gaattgccct tccccggcaa ccaggacagc gagtccgacg acacaaatat cctcatctat       480
     ggaggggcaa cggctactgg tacacttgcg atccaattgg cgaaattatc gggactgcgc       540
     gttgtcacga cgtgctccga agccaaccgc agcttcatgt ttgagcttgg ggccgacgcg       600
     gtctttgatt accacgatcc actggtgggc gagcagatcc gagaggatac tgatgatgcg       660
     ctggaatttg ttcttgatac gatctctacg ccacaatcgg ctgccatctg cagtgcggcc       720
     atttcgtcgg cgggtggttc atacaatgct ctgctggatg tggcatccgc gagggacgat       780
     gttgattcac atgtctcgat ggcgtatgat gtcctaggag agccgtaccg catgggaacg       840
     aacgagagag ctcctgatag cactaacttt gaattcggcg tcaaatggtg gggattagcc       900
     cagaaactaa tcgaggagcg tcgcattcat cctcatccgt atcaggtgaa accaggcggt       960
     ttggcgggag cgttggccgg ccttcagata ttgcgagaag gtaaagtccg agcctccaag      1020
     ctagtctatc gggttgatga atccgagtaa                                       1050
//

If you have problems or comments...

PBIL Back to PBIL home page