(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_13.PE379

PENCW_13.PE379       Location/Qualifiers
FT   CDS_pept        join(854618..854677,854767..854963,855072..855111,
FT                   855191..855244)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15947714"
FT                   /orf_name="Pc16g03790"
FT                   /product="Putative uncharacterized protein Pc16g03790 "
FT                   /protein_id="CAP93049.1"
FT                   /db_xref="UniParc:UPI0001831253"
FT                   /db_xref="UniProtKB/TrEMBL:B6H7Y8"
FT                   /transl_table=1
FT                   /translation="MPPSHNSQMPHGIVILIAKEVELVSNRGLGEESDSTAGEEKQKEK
FT                   KGKEKRKRGRQGIFTLACWNRLEWRLEASPGNTVTDTRIVSGKQTTFRKVWNSLGNMDS
FT                   TSQNPDVIRAPT"
     atgcccccca gtcacaacag tcaaatgcca cacgggattg tgatattgat agctaaagag        60
     gtggaacttg tctcaaatag ggggctggga gaggaaagtg actccactgc gggagaggaa       120
     aaacaaaagg aaaaaaaggg aaaggaaaag aggaaaagag gaagacaggg gatcttcaca       180
     ttggcttgtt ggaatcgact ggagtggaga cttgaagctt cgcctggaaa taccgtgacc       240
     gatactcgta tcgtctcggg taagcagaca accttcagga aagtatggaa cagcctgggg       300
     aacatggact caacaagcca gaatccagac gtaatccgag ctccgacata a                351
//

If you have problems or comments...

PBIL Back to PBIL home page