(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_13.PE380

PENCW_13.PE380       Location/Qualifiers
FT   CDS_pept        join(855495..855698,855758..855902,855964..856232,
FT                   856290..856652,856717..857644,857721..862063,
FT                   862121..862790,862853..863004)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000160879" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20671665"
FT                   /orf_name="Pc16g03800"
FT                   /product="Pc16g03800 protein"
FT                   /function="acyl carrier activity"
FT                   /function="cofactor binding"
FT                   /function="transferase activity"
FT                   /biological_process="biosynthetic process"
FT                   /protein_id="CAP93050.1"
FT                   /db_xref="GO:0000036"
FT                   /db_xref="GO:0009058"
FT                   /db_xref="GO:0016740"
FT                   /db_xref="GO:0048037"
FT                   /db_xref="InterPro:IPR000794"
FT                   /db_xref="InterPro:IPR001227"
FT                   /db_xref="InterPro:IPR006163"
FT                   /db_xref="InterPro:IPR009081"
FT                   /db_xref="InterPro:IPR011032"
FT                   /db_xref="InterPro:IPR013968"
FT                   /db_xref="InterPro:IPR014030"
FT                   /db_xref="InterPro:IPR014031"
FT                   /db_xref="InterPro:IPR014043"
FT                   /db_xref="InterPro:IPR016035"
FT                   /db_xref="InterPro:IPR016036"
FT                   /db_xref="InterPro:IPR016038"
FT                   /db_xref="InterPro:IPR016039"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="InterPro:IPR018201"
FT                   /db_xref="InterPro:IPR020801"
FT                   /db_xref="InterPro:IPR020807"
FT                   /db_xref="InterPro:IPR020841"
FT                   /db_xref="InterPro:IPR020842"
FT                   /db_xref="UniParc:UPI0001831254"
FT                   /db_xref="UniProtKB/TrEMBL:B6H7Y9"
FT                   /transl_table=1
FT                   /translation="MPGRPTSAPTEMEGIAVIGMGCRFSGGATSVENFWQMLCDGRTGH
FT                   GTVPTSRYEASAWHHPSHERKGAINHDSGFFLQEDPSRFDAPFFSITAKEAAGMDPAQR
FT                   LLLEVAYETFENSGIPIDTLPGSNTAVYSGSMTNDYELLSTRDIYDMPHNSATGNGRTM
FT                   LANRLSWFFDLQGPSIMMDTACSSSLTAVHLAAQSLRSGECGMALVTGASLILHPNFTQ
FT                   RLSYMHMMSADGISHSFDESANGYGRGEGIGAVLLKPLSAALADGDNIRAVIRGTGINQ
FT                   DGRTPGITLPSPTSQANLIRSVYERHGISMRDTSYFEAHGTGTPVGDPTELSAVGATLG
FT                   QARTPTDEPIYVGSVKTNFGHTEGAAGVASLIKVVLCLEKGMLVPNAGFKNINPKIRLD
FT                   DWRLRLSDKTMPWPDHLPQRASINSFGFGGSNAHLILESTKEALGGNAEDKEPAPHVVV
FT                   FSTFDQAGIERASQNWSTFLQRQQKTEQEIPLKDLAHTMLTRRSQLGFRSFAVANSQDQ
FT                   LQTILDKGLPKFPRASRKAQTRLAFVFTGQGGQWAGMGRELLRISTFRESIARSQDILS
FT                   SLGCPFDMVEEIKAEAKDSQINRPDRSQPITCALQIALVDLLASWSVYPNAVVGHSSGE
FT                   IAAGYAAGYLSREDAMRVAWFRGFFSQQIAQSDRRGGMLATGISAADAQKYLQELPPRS
FT                   VVVACVNSPASTTLSGDVDLIDKLEARLQQDGHFARKLRIDTAYHSPHMEDLVEVVGNA
FT                   INCIKPEDRYSGSIPMLSSVTKERVYPAELGGSYWVRNMISSVEFTAAVSQLANLSESI
FT                   KSRRRPVPIKWTALVEIGPHAVLKGPVTQILQSVNPSMASLPYYSLVSRNQHALRTALE
FT                   VAGSLWSTGHTVDLAAVNSSVDTTSPKMVADLPSYPWNHQTSFWHEPVETAQLRQRKHP
FT                   RHDILGAAVDYQNALEPRWRNFLRLSENPWMADHVVAGSIVFPAAGMLVMATEAARQLA
FT                   DDQANIKGIEFQDLRFMRGVVIPDEERGLETLLQVSPHPGMPGWYQFGIFSLPSGGAWI
FT                   QHAKGAFIARYENRDNDEHNANWEAALERIKNTQTVAKMADVRQSREWLSHTGGLTVGP
FT                   AFQTITGVSFCDAEPRLWLSGVVTDTKQSMPFEKESPSFIHPTTLDCLFQSALLSCSDA
FT                   LSNNNANIPVGVDNIYISNAFQPQAGEQFVVHTETKWRDGKSRSHCIASDPSWSQPWIT
FT                   FEGVHLGRLPFNPNSQKKVEATSESRYSSIVWDEHLESPLVTNQIHDGNKKMAVQASRL
FT                   QLTDWIKRLCHTNGDAKALITTSETSNSWIENLQELISSAGKRPCLGKVTIASCGPNDQ
FT                   VNGITPAENSLPGTQLMPLATLDELPSSSLAQEKYDLVVIDEPRLWEDKLTQVILSCLP
FT                   NILEHGGLAAMRVSDTDLDSAAEKLQRFDGLEIHSTTQNRKFIIARRTPVSWTTDSEIY
FT                   VLSPADNSNSFPVFEHLEKIFATHNVRLVPVGLGQVATLAGKTVISLLDLAAPWVAGWT
FT                   ENDLERLRELIRVQYVLWVSPCWSQGAVDNIGSGATGGLLRTLRNEQWNTTIPHLLVDV
FT                   EDMEDKFGLACGILQVMQLTTQESARRPDLEYRLANGRLLVPRVLETPAVDEAMHTLIN
FT                   GPRPVLSDLTLDPRPLELKFQDADNARWEEQQLSEEQLRPDHSEIKVEMATIFDLHGEQ
FT                   GKTPETVLPMFEIVGTVTRIGSDVHDSAVGDKVLTLASANSGLSTTMRVSESDTIRIPA
FT                   NTDATKAISTPLAYLNAYQILTQVGRLSSSSSVLLVGSVNQTLQAMIDYALAMNMQVIV
FT                   ATDSLDSTESLRSRYPVLADRILGVQGSLETSVSRLTNGCGVDATICFLGGYAGRNAAR
FT                   CLVQGGQYINLSSEMKLSALPESFVDSGCTFSSPRLQKAFSEKPGNLHASLRHVIDFMK
FT                   QHRMLDRVESYSLFPISDLQGALKHCKATNTRAIMDLQAPGRVPIVLPLPDLTGLPAGG
FT                   TYILAGGLGNLGLALADTLVQSGARHLVFLGRSGGTQPSQQLALDQLRDRGCCIDVLRC
FT                   DISQQGDIDHLSYKIRSKNWTVAGVIQCTTVLRDAMFEKMTFDDWTQSTQSKIRGTLNL
FT                   HHLFSEKEGLTFFVALSSVASVIGNMGQANYSAGNGFIDALMEWRRSHGLPGHSINIGL
FT                   VPDASGLSDIAEDQEQRRRRYKHLEGTEIMTHELQTLLRVIINSKLSLPSQIIAGMTDS
FT                   LSRSNGSTPWVLDRKFDHRLCLAVEDTQDSIQTSTLLKECDSIDAATEIVLNTLSEYLA
FT                   DAMATTADAIDSDLPLSALGVDSLKATAVQNWVSRELGAELSSFEFLGSQPTKALARKI
FT                   ASTSSFVSVPS"
     atgcctggcc gaccgacttc cgcccctacc gagatggagg gaattgcagt cattggaatg        60
     ggctgtcgct tctctggagg agcgacctcc gtcgagaact tctggcagat gttatgcgac       120
     ggacgcactg ggcatggaac ggtccctacg agccgatatg aagcttcggc ctggcaccac       180
     cccagccatg agcgcaaagg agcgatcaat catgatagcg gattcttttt gcaggaagat       240
     ccatcacgat ttgatgctcc ctttttctct atcacagcca aagaagcggc gggcatggac       300
     ccagcacagc gtttgttgct tgaagtcgca tatgaaacat ttgaaaacag tggaatacca       360
     atagacacac ttccagggag taacacggca gtgtactccg gctcaatgac caatgattat       420
     gagctattat cgacaagaga catctacgat atgcctcaca actcagctac tggtaatgga       480
     aggactatgc tggcaaatcg tttgtcctgg ttctttgatc ttcaaggccc gagtatcatg       540
     atggatactg cgtgttcctc cagtttgaca gcggtccatt tagcagccca atccctgcga       600
     tctggagaat gcggaatggc tttggtaact ggagccagtc tcatcttgca ccctaatttc       660
     acacaaagac tctcctacat gcacatgatg agtgcagacg ggataagcca ttcatttgat       720
     gagtctgcaa atgggtatgg tcgaggagaa ggtatcggtg ctgtactttt gaagcccctc       780
     agcgccgcat tggccgatgg agataatatt cgagccgtca tccgcggcac aggaatcaat       840
     caggacggtc gtacacccgg aattactctg cccagtccta cgtctcaagc caacctgatt       900
     cgttcggttt atgaacgcca tggcatctca atgagagata cttcctactt tgaagcccat       960
     ggcactggaa ctccggtcgg ggatcccaca gaactgtctg ctgtcggagc cactctgggc      1020
     caggcacgaa caccgactga tgagccaata tacgtaggct cagtgaagac aaattttggt      1080
     cacaccgaag gagccgcagg agtggctagc ttgatcaaag tcgtcctatg tttagaaaag      1140
     ggcatgctgg tgccaaacgc cggcttcaag aacatcaatc ccaagatccg actcgacgat      1200
     tggcgtttac gtctaagcga caaaacgatg ccatggccgg accatcttcc acagcgagct      1260
     agtatcaact catttggatt cggtggttca aatgcgcacc taattctcga aagcaccaaa      1320
     gaggccctcg ggggtaatgc tgaagacaag gaaccggccc ctcacgtggt tgtgttttct      1380
     acgtttgatc aagctggcat tgaacgggcc agtcaaaatt ggagcacatt ccttcaacgt      1440
     cagcagaaga ccgaacagga gattccacta aaagacttag cccatacgat gctgacacgc      1500
     cgatcgcagt taggcttccg cagtttcgcg gttgctaact cacaagacca gctgcagacc      1560
     atcttagaca agggactccc caagttccct cgagctagtc gcaaagccca aacgagactt      1620
     gcctttgtgt tcacaggtca gggtggccag tgggctggaa tgggtcggga gcttttgaga      1680
     atttccactt tcagggaaag catagcacga tcacaagaca ttctctcgtc cctgggatgt      1740
     ccctttgaca tggtggagga gatcaaggct gaggcaaagg acagccagat aaaccgaccc      1800
     gatcgcagcc agcctattac ctgcgcgttg cagattgcat tggttgatct tttggccagt      1860
     tggtcggttt atcccaacgc agtggtcggt cattctagcg gtgaaattgc cgctggatat      1920
     gctgctgggt atctttctcg tgaagacgct atgcgagtcg cctggttccg cggtttcttt      1980
     tcacaacaga ttgctcagag tgacagacga ggaggtatgc tcgctactgg tatttccgca      2040
     gcggacgcac agaagtatct tcaggagttg cccccacgtt cggttgtggt tgcctgcgtc      2100
     aatagtcctg ccagtacaac cctttcgggt gatgtggact tgattgataa gcttgaggca      2160
     agattacaac aagatggtca ctttgcccgg aaactgcgca ttgatacagc ttatcattct      2220
     cctcacatgg aggacctcgt tgaagtggta ggtaatgcca tcaattgtat caagccagaa      2280
     gatcgataca gtggctcaat tcccatgctt tcatcggtca ccaaagagcg tgtctatccc      2340
     gccgagcttg gtggatcata ctgggtgcgc aacatgatca gctcagttga gttcacagcc      2400
     gcagtctcgc agctcgcaaa tttgagcgag tctatcaagt ctcgccgccg gccggttcca      2460
     attaaatgga ctgcattggt tgaaatcggc ccacacgccg tcttgaaggg acctgtcact      2520
     cagattctgc aatccgtcaa cccaagtatg gcatcgttgc cttattattc actggtttcg      2580
     cggaaccaac acgctttgcg aaccgccttg gaagttgccg gttctctttg gagcacaggc      2640
     catacagtgg accttgctgc agttaacagt agtgttgaca ctacaagccc aaaaatggtt      2700
     gctgatttgc cttcttatcc ctggaatcac caaacgtcct tctggcacga gccggtagag      2760
     acagcgcaat tgagacaacg aaaacatccc cgtcatgaca ttttgggagc cgccgtggat      2820
     tatcaaaatg ctttggagcc acggtggaga aacttcctgc gactctcgga gaatccatgg      2880
     atggctgatc atgttgtcgc cggatcgatc gtattcccag ctgcgggcat gttggtgatg      2940
     gctacagagg cagcgcggca actagctgat gaccaggcca acatcaaggg aatagaattc      3000
     caagacctcc gtttcatgcg aggagtggtt attccggacg aagagcgagg cttggaaact      3060
     ctccttcaag tttctcctca tccaggaatg cccggttggt atcaattcgg aattttctca      3120
     cttccctccg ggggtgcctg gattcaacac gcgaagggtg cattcattgc gcggtacgag      3180
     aaccgagaca atgatgaaca caacgcaaat tgggaagcag cattggagcg catcaagaat      3240
     acccaaacag tcgccaaaat ggctgatgtt aggcaatcac gtgaatggtt gtctcacacc      3300
     ggaggactca ctgtaggacc ggccttccag acaatcaccg gtgtgtcctt ctgcgatgca      3360
     gagcctcgtc tctggctatc tggtgtagtc acagacacca aacaatcaat gcccttcgaa      3420
     aaggagtcac ccagcttcat ccaccccaca actcttgatt gtctcttcca gtctgccctt      3480
     ttgtcttgct ccgatgcact atctaacaac aacgcgaata tccctgtcgg agtggacaat      3540
     atctacatct ccaacgcctt ccaaccccaa gcaggggagc aatttgttgt ccacacagag      3600
     actaagtggc gagatggaaa atctcgatcc cactgtattg cgtcggaccc ctcctggtca      3660
     cagccctgga ttacgtttga aggcgttcat ctcggtcgcc ttcccttcaa ccccaattct      3720
     caaaagaaag tggaagcaac ctcagaaagc cgatactcgt cgattgtttg ggatgaacac      3780
     ttagagtcgc cgcttgtcac taaccaaatc catgatggaa acaagaagat ggccgtgcaa      3840
     gcaagccgtc ttcagctgac agactggatc aagagactgt gccataccaa tggggatgcc      3900
     aaggcgctca tcactacttc ggaaacatca aactcctgga ttgagaacct ccaagagcta      3960
     atctcaagtg ccggaaagcg accttgcctc ggaaaggtca ctatcgcttc atgcgggccc      4020
     aatgaccaag tgaatggcat cactcccgca gagaactctc tcccgggtac tcagctgatg      4080
     cccctcgcta cgctcgacga acttccatct tcatcgctcg ctcaggagaa atatgatttg      4140
     gtcgtgatcg atgagcccag gctgtgggag gataaattaa cccaagttat tctttcgtgc      4200
     ctgcccaaca ttcttgaaca tggaggttta gctgcaatgc gcgtgtctga caccgacctg      4260
     gactcagcag cggagaagtt gcagcgcttc gacggcctcg aaattcacag cacgacccaa      4320
     aatcgcaagt ttatcatcgc acgcaggacg ccagtctcat ggacaacgga ctctgaaatc      4380
     tatgttttga gtccagcaga taattccaac tcattccctg ttttcgagca cctcgagaag      4440
     atctttgcca cccataacgt tcgcctggtg cctgttggat tgggacaggt ggctactcta      4500
     gcaggaaaga ccgtgatttc gttgctcgat ttggcagctc cctgggtggc cggctggacg      4560
     gagaatgacc tggaacgtct tcgagagctg atccgagttc aatacgtcct ttgggtgtcg      4620
     ccgtgctgga gccaaggcgc tgttgataat atcggctccg gcgccacagg tggtcttttg      4680
     cgaacacttc gcaatgagca gtggaacacg acaattccac acctattggt ggatgtggaa      4740
     gatatggaag acaaatttgg actggcctgt ggcattctcc aagtcatgca actcacgacg      4800
     caggagagtg cacgtcggcc agacttggag tatcgtctag caaacggtcg gctgctagtc      4860
     ccgcgtgtcc ttgagacccc agcggtggat gaggccatgc acactctgat aaacggcccc      4920
     aggcccgtat tgtcggacct aacacttgat ccaagacccc tcgagttgaa gttccaggac      4980
     gcagacaacg cacgctggga ggaacagcaa ctctctgaag agcaactccg gccagaccac      5040
     agtgagatca aggttgaaat ggccactatc tttgatttac atggtgaaca gggaaagaca      5100
     ccagagacag ttcttccaat gttcgaaatt gttggaacgg taactcgtat cggatctgat      5160
     gtgcacgact cggctgttgg cgataaggtg ttaacattgg catcggcgaa ttcgggactc      5220
     tcgacaacaa tgcgtgtctc ggaaagtgac actatccgga ttcctgcaaa caccgacgca      5280
     acaaaggcga tatcaacccc tctcgcatac ctcaacgctt atcaaattct cacccaggtc      5340
     ggtcgcctca gctcgagttc ctcggtgctg ttggttgggt cggtcaatca aactctccag      5400
     gccatgatag attatgccct tgccatgaac atgcaagtca tcgtggcaac tgattcactg      5460
     gatagcacag agagccttcg ctctcgctac ccagtactgg cggatcgaat tctgggcgtt      5520
     caaggtagcc tggaaacgag cgtgtccagg ctgacgaatg gatgtggagt tgacgccacc      5580
     atttgcttcc ttggtgggta tgcgggtcgg aatgctgcga gatgtctggt ccaaggtgga      5640
     cagtacatta atctgtctag cgagatgaag ttgagtgctc ttccagagag cttcgtcgac      5700
     agtggctgca cgttctcttc gccgcgactg cagaaggcat tctcagagaa gcctggcaac      5760
     ctccacgctt cactccgaca tgtgattgac ttcatgaagc agcatcggat gttggaccgt      5820
     gtggaatcat attccttgtt ccctatttct gatctccaag gagccttgaa acactgcaaa      5880
     gcgactaaca cccgagctat catggacctt caggctcctg ggagagttcc aattgtgctg      5940
     ccactgccag atcttactgg cttaccggca ggaggcacat acatactagc aggtggattg      6000
     ggcaatctcg gccttgcgct tgccgatacc ttggtgcagt ctggggctcg tcatttggtc      6060
     ttcctcggaa gatctggagg gacgcaaccg agtcagcagc tagcccttga tcaacttcgc      6120
     gatcgcgggt gctgcataga tgtactacgc tgtgacatct ctcaacaggg agacattgac      6180
     cacctgtcat acaagattcg cagcaaaaac tggactgtcg caggcgtgat tcagtgtaca      6240
     acagttctaa gggacgcgat gttcgagaag atgacttttg atgactggac tcaatccacc      6300
     cagtccaaga tccgcggaac acttaacttg caccatctgt tctcggagaa ggaaggcttg      6360
     actttcttcg tggcgttgtc ttccgtggcc agcgtcattg gtaacatggg gcaggctaac      6420
     tattctgcgg gcaatggctt cattgatgct ctcatggaat ggcgacgcag tcatggtctc      6480
     ccaggacatt ccatcaacat cggcctcgtg ccagatgcca gtgggctcag tgacattgcc      6540
     gaagatcaag agcaacgccg tcgccgatac aaacatctcg agggaacaga aatcatgacc      6600
     catgagctcc agaccttgct cagagtgatc atcaacagca aactttccct tccgtctcag      6660
     atcattgctg gcatgactga ttccctgtct cgcagcaatg gctctacacc ctgggtactc      6720
     gaccgaaagt ttgatcaccg gctttgtctc gctgttgagg atactcagga ttctattcag      6780
     accagcacct tgcttaagga gtgtgattcc atcgacgctg caaccgagat tgtcctaaac      6840
     actctgagtg aatatctagc ggatgcaatg gccacaaccg ctgatgctat cgactcagat      6900
     ctaccattgt ccgcgctggg tgttgattcc ctcaaagcta cagctgtcca aaactgggtc      6960
     tctcgcgaat taggggcaga actgtcctcc ttcgaattcc tcggctcgca accaaccaag      7020
     gcgttagcga ggaaaattgc ttccactagc tcgtttgtct cagtgccgag ctga            7074
//

If you have problems or comments...

PBIL Back to PBIL home page