(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_13.PE386

PENCW_13.PE386       Location/Qualifiers
FT   CDS_pept        join(878527..879492,879546..879908)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000178241" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20671666"
FT                   /orf_name="Pc16g03860"
FT                   /product="Pc16g03860 protein"
FT                   /protein_id="CAP93056.1"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="InterPro:IPR019432"
FT                   /db_xref="UniParc:UPI0001831325"
FT                   /db_xref="UniProtKB/TrEMBL:B6H7Z5"
FT                   /transl_table=1
FT                   /translation="MSSSTLPLVRLPEPYKTTYELHVVSTDRNLRKFQLLRAPRGDEGI
FT                   PPPKPLDHASLKFTDLAQPDPSSTPDEGNNSPWARAQRSPVTYITWEGSDTPTVGQIWN
FT                   VVYAIETLRSEFEIFRGVLSGTGSEILARELEGVGLAIAHPEPSAAPGKPIPTTTNHLG
FT                   QLVFSRSSFWQGAGSPFGTRPAWVSDPGIYSYMRKPLSEYPCRPRQHTVTTGFPERRVH
FT                   ALHPVRPPKPSPGSCIYSRYIPHLDEFFSVYALDYTNEEHLGLFNKWQNDPRVAQGWNE
FT                   TGTLEQHREYLRKIQEDPHQIAVLAKFNDTFFSYHEIYWAKEDHLGAYYDAGDWDRGRH
FT                   SLVGDERFRGPHRTIAWWSGLMHYIFLDDPRTEYVTGEPKYSNLAPLTYDHATGMNLAK
FT                   LVDLPHKRSALILGSREKFFHVAPLRFDGSDTLDRNPFRSLKL"
     atgtcctcga gtactctccc ccttgtgcgg ctaccggagc cgtacaagac gacttatgaa        60
     ttacacgtcg tatctaccga ccggaatctc cgcaagttcc agctgctgag agctcctcgc       120
     ggagacgaag gcattccacc cccaaagcca ttggaccacg cgtcgttgaa gtttacagat       180
     ttggcccaac ctgatccttc ttccacacca gatgagggaa acaactcacc ctgggcacgt       240
     gcacagagaa gtccagttac ctatattaca tgggaagggt cggacacgcc gacggtgggc       300
     cagatctgga atgtggtcta tgccattgag accctgcgaa gcgagttcga gatattccgc       360
     ggtgtgctgt ctggtactgg gagtgagata cttgcacggg agctagaagg cgtgggattg       420
     gccatcgcgc atcccgagcc atctgctgcg ccaggaaaac ccatcccaac caccactaac       480
     cacctcggac agctggtctt ttcccgcagt agcttctggc aaggagctgg ctcacccttt       540
     ggcacccgtc cagcgtgggt gtccgacccg gggatttaca gctatatgcg caagccgttg       600
     agcgaatacc cttgccgacc acgccaacac accgtcacca ctggcttccc cgagcgtcga       660
     gtacacgccc ttcaccccgt acgaccacct aaaccatctc ccggctcttg catctacagt       720
     cgctacattc cacacttgga cgagtttttc tcagtctatg cgcttgacta cacaaacgag       780
     gaacacctgg ggctgttcaa taagtggcaa aatgaccctc gagtcgctca ggggtggaac       840
     gaaactggaa ctttggaaca acaccgcgaa tacttgcgca aaatccagga ggatccgcac       900
     cagatcgctg tgctagccaa gttcaacgat actttctttt cctatcatga gatatattgg       960
     gcgaaggagg accatctcgg tgcgtactac gatgctggtg actgggacag gggccgccat      1020
     tcactagtcg gtgatgagcg tttccgaggc ccgcaccgca ccattgcgtg gtggtctgga      1080
     ttgatgcatt acatcttcct ggatgatccc cgtacggagt atgtgactgg agagcccaaa      1140
     tactccaacc tggctcccct gacctacgac cacgctacgg gcatgaatct ggccaagctg      1200
     gttgatctgc cacataaacg gtcggcgctc attctgggta gcagggagaa gtttttccac      1260
     gtggcgccgc tgcgattcga cgggtctgac actctcgacc gcaatccctt ccgctcattg      1320
     aagttgtaa                                                              1329
//

If you have problems or comments...

PBIL Back to PBIL home page