(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_13.PE387

PENCW_13.PE387       Location/Qualifiers
FT   CDS_pept        join(880563..880595,880644..881562,881621..884634)
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI19824347"
FT                   /orf_name="Pc16g03870"
FT                   /product="Pc16g03870 protein"
FT                   /function="ATP binding"
FT                   /function="ATPase activity, coupled to transmembrane
FT                   movement of substances"
FT                   /cellular_component="integral to membrane"
FT                   /protein_id="CAP93057.1"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0016021"
FT                   /db_xref="GO:0042626"
FT                   /db_xref="InterPro:IPR001140"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR011527"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR017940"
FT                   /db_xref="UniParc:UPI0001831326"
FT                   /db_xref="UniProtKB/TrEMBL:B6H7Z6"
FT                   /transl_table=1
FT                   /translation="MAEDAPAQKRSWRDRAVFFRLFVYGEPSRSDIALLVLGLVSAIAS
FT                   GIPFPIMSIVFGQLVDEMNSTTCNVNDTNGDAYQAGINDKVLMIVYIGIAYLVLIYIYV
FT                   FSWNLTGERLAQRLREKYFKALLRQDVAFFDNLPAGEASSRITGDITTVQQGTSEKVGI
FT                   VINSLAFFVTAYVVAFIKDPKLAGMLVSLTPAYLIMSLLGGYFVQKYFGRALESMTKAS
FT                   SVALEAFSNTMVVHAFSANARLEEKFIEFLNPGRIAGIRKSIATATQAGLLYFIAFSAN
FT                   ALAFWQGSTKIADSVESNDSSMTVGATYTVIFILVDASLILSTVAPFIQSFDAASVAFT
FT                   KLKADIDHSSAIDGTSKDIGEVLPEVKGHVELRDVSFCFPSRPDKPVLQNLSLSCPAGK
FT                   QTAIVGLSGSGKSTVAGLATRFYDATEGTVMLDGHDVKDLNVRALRSHISLVQQEPCLL
FT                   DRSIFENIAMGLINSPAHTHLQPILTGTALIEIAAAVREGQALSAAALEHGDQAREVVD
FT                   LVESATKLADANVFIEKLQEGYGTSVGSSGNLISGGQKQRISLARALVKDPRILILDEA
FT                   TASLDSATEMRIQRALESVAVGRTVITIAHRLSTIRNADNIIVMRQGKLVEQGTHTELL
FT                   AANGAYAELIRLQNLNVENSQEGTSTRSASPVTQITEKVEPNLSVTDDVPDKDETVDTP
FT                   AAQESKPKETGGVVDTNRSFASTVGSLGSMFRPYSFVLVLAVTGAVVIGGTYCASAVIF
FT                   GNVVGKLSGCEEPQNIRDAGEFYGLMFFVLAIIEFFANFFSWSLFGWMAENVIYKVRVL
FT                   SLRAILEQDLQWHESNDRNPSLLLSLITKDSNALAGLTGSVVCTILSILINLFAAIIMS
FT                   HIIAWRIAIVCLAVVPLLLAAGWMRVTSLAQFEERHLEAFARSVGITVEAVNSIKTVMS
FT                   LSVEDEIMGTYRRSLAAPMREITRQSAWANVWLAIGYGLSNFLYGLAYWWGAKNIIAGY
FT                   YSQTQFFIVQLALLVSSQLWGQMFALAPDVSRAFQATRRLLNLLDLGTTKKLSAPIELL
FT                   PSKLLQSTSDVESTANAREKVDDTRNGISVSLKQVHFAYPARPDTRVLHGLDIDVKPGQ
FT                   FAALVGPSGAGKSTIISLVERLYSPESGTIHVDGRDVAYGDISFRDNIAYVPQQSVMFE
FT                   GTIRFNLALGARPGHEVTQDELEEACKLANIHDVISQLPDGYDTHCGPNGDRLSGGQKQ
FT                   RLAIARALIRKPKLLLLDESTSALDAESERLLQDGLEKAAKNMTVIAIAHRLYTIRKAD
FT                   VIFLIEDGRCVEQGTHTQLIERSETYRVNALNQTVDG"
     atggccgaag atgcaccagc gcagaagcgc agctggaggg acagagctgt cttcttccgc        60
     ctgtttgtct atggcgagcc cagcagatca gatatcgcac tccttgtgct cggccttgtc       120
     tccgcaattg cctccggaat accctttccg atcatgtcaa ttgtgtttgg tcaactggtg       180
     gatgaaatga actcgacgac ctgcaatgtc aacgacacca atggcgacgc ataccaagct       240
     ggtattaacg ataaagtctt gatgattgtc tacatcggca tcgcctacct cgttttgatc       300
     tatatttatg tgtttagttg gaatctgact ggcgagagat tggctcagcg tctgcgcgag       360
     aaatatttca aagccctcct ccgccaggat gtggccttct tcgacaacct cccggctggc       420
     gaggcgtctt cgagaattac aggcgacatt accaccgtgc aacaaggaac gtccgaaaag       480
     gtcggcattg tgatcaacag tctggccttc ttcgtcaccg cgtatgtcgt ggctttcatt       540
     aaggatccca agttagctgg aatgttggtc tccctgactc ccgcctactt gatcatgtct       600
     ctgttgggag ggtattttgt gcaaaagtat tttggtcgcg cactggagag catgaccaag       660
     gcatcctcag ttgcactgga agcattttcc aacactatgg tggtccatgc tttctcggcc       720
     aacgcgcggc ttgaggagaa gttcatcgag tttttgaacc ctggaaggat tgccggaatt       780
     cgcaagtcaa ttgccacggc tactcaggcc ggtttgcttt actttattgc tttctcggcc       840
     aatgcactgg ccttctggca ggggtctacg aagattgcgg attcggtaga gtccaatgac       900
     agcagcatga cagttggcgc aacatacacc gtgatcttta ttcttgtgga tgcgtccttg       960
     atcctcagta cagtggcacc tttcatccaa agcttcgatg ccgcctcggt tgccttcaca      1020
     aaattgaagg ctgacatcga ccactcgtcc gcaattgatg gcacttcgaa ggatattgga      1080
     gaagtattgc ccgaggtcaa gggccatgtg gagttgcgcg atgtttcatt ctgtttccct      1140
     tcccgcccag ataagccagt ccttcaaaac ctgtcgcttt cctgtcccgc cggtaaacag      1200
     actgccatcg tcggcttgtc cggaagtgga aagtctactg ttgccggctt agcaacaaga      1260
     ttctacgatg ctaccgaggg aactgttatg ttggacggac atgatgtcaa agatctgaat      1320
     gtgcgtgcat tgaggagcca tatcagtctt gtccaacaag agccatgtct tcttgatcga      1380
     tcaatctttg agaacattgc catgggcctg atcaattccc ctgcacacac gcatcttcaa      1440
     ccgatcctga ctggcaccgc gctgattgag attgctgccg ctgtgaggga gggccaggct      1500
     ctttcggccg cggctctaga acacggtgac caggcgcgag aggtggtgga cttggttgaa      1560
     agtgccacaa agctggctga tgccaacgtg tttattgaga aacttcaaga aggctacggt      1620
     acttcggtcg gttccagcgg gaacctgatc agtggcggac agaagcagcg tatctctttg      1680
     gcccgagcct tggtgaaaga cccgcggatt ctcattctcg acgaggccac agcgtctttg      1740
     gactcagcaa cagaaatgcg catccaaaga gccttagaga gtgtggccgt gggccggact      1800
     gttattacca ttgcgcaccg cctatctacc atcaggaatg cggataacat cattgtcatg      1860
     agacaaggaa agcttgttga acaaggcact catacggagc tactggcggc caatggtgcc      1920
     tacgcagagc tgattcgcct tcagaacctc aatgtcgaga attctcaaga gggaacatct      1980
     actcgatcgg cgtcgcctgt gactcaaatc acagaaaagg tcgaacccaa tctttccgtg      2040
     actgatgatg ttcccgataa agatgagacg gtcgataccc ccgctgccca agagtccaag      2100
     cctaaagaaa ccggcggtgt tgtagacaca aacaggtcat ttgcctcaac agttggatcc      2160
     ctgggctcta tgttccgacc gtattcgttc gttctggtac tcgcagtgac cggtgctgtt      2220
     gtcatcggcg gcacatattg cgcttcggca gtcatctttg gtaatgtcgt gggtaaactg      2280
     agtggttgtg aggaacctca gaatatccgc gacgctggag aattctacgg tctcatgttc      2340
     ttcgtcctcg ctatcattga attctttgca aacttcttca gctggtctct ctttggttgg      2400
     atggcggaga acgtgattta caaagtgcga gttctttcac tacgagccat tctcgagcag      2460
     gatctccaat ggcacgaatc caatgaccgc aacccatcat tgctgctttc cttgatcaca      2520
     aaggacagca atgctcttgc aggcctgacg ggctccgttg tctgcacaat tttgtctatc      2580
     ctaatcaacc tcttcgctgc catcatcatg tcgcacatta tcgcgtggcg catcgccatc      2640
     gtctgccttg ccgtggtacc tttgctactg gctgctggct ggatgcgagt tacctcactg      2700
     gcacagtttg aggagcgcca tttggaggct tttgctcggt ctgtgggaat tacagtggag      2760
     gctgtcaact cgatcaagac cgtcatgtct ctctctgtgg aagacgagat tatgggaaca      2820
     taccgtcgct cattagcggc acccatgaga gaaattaccc gccaaagtgc ctgggccaat      2880
     gtctggcttg ccatcggata cggtctcagc aacttcttgt atggcctggc atattggtgg      2940
     ggagcgaaaa acatcattgc aggatactat agtcagacac agttcttcat cgtccagcta      3000
     gcgctgctcg tcagctcaca gctgtgggga cagatgtttg ctctggcccc tgatgtctca      3060
     cgtgccttcc aggccacccg ccggttgttg aatctgctag acctgggcac cacgaagaaa      3120
     ctgtcagccc ctatcgaact tctgcctagc aagcttttgc aatctacgag cgacgtcgaa      3180
     tccacggcaa acgcccgcga gaaggtcgat gacactcgca atggcatcag tgtctccctt      3240
     aagcaagtcc actttgcgta tcccgcgcgc ccagacaccc gcgtgctcca tggtttggat      3300
     atagacgtca agccaggtca gtttgccgct ttggtcggac ccagtggtgc tggaaaatcg      3360
     accatcattt cacttgtgga gcgcctctac tcccccgaat ccggtaccat ccatgttgac      3420
     ggccgagacg ttgcctatgg tgacatctca ttccgtgaca acattgcata cgtaccacag      3480
     cagagtgtta tgttcgaagg aactattcgc ttcaaccttg ctcttggcgc acgacctggt      3540
     cacgaggtta cgcaagacga gttggaagaa gcatgcaagt tagccaatat ccacgacgtt      3600
     atttcgcagc ttcccgacgg atacgataca cactgcgggc caaacggtga tcgtctctcc      3660
     ggaggtcaga agcagcgact ggctattgcg cgggcgctga ttcgaaagcc aaagctgttg      3720
     ctcctagacg agtcgaccag tgctttggat gcggagtctg agcgactgct tcaggatggg      3780
     ttggagaagg cagccaaaaa catgactgtg atagcgattg cccatcgttt gtacacgatc      3840
     cgcaaggcgg atgtcatttt cttgattgag gatggccgtt gtgttgagca aggcactcac      3900
     acccaactga tcgagcggag cgagacttac agagtcaatg ccctgaacca gacagtggat      3960
     ggataa                                                                 3966
//

If you have problems or comments...

PBIL Back to PBIL home page