(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_13.PE388

PENCW_13.PE388       Location/Qualifiers
FT   CDS_pept        join(complement(885998..886193),complement(885592..885942),
FT                   complement(884877..885539),complement(884789..884829))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000203127" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15947716"
FT                   /orf_name="Pc16g03880"
FT                   /product="Pc16g03880 protein"
FT                   /function="flavin adenine dinucleotide binding "
FT                   /function="oxidoreductase activity"
FT                   /biological_process="oxidation-reduction process "
FT                   /protein_id="CAP93058.1"
FT                   /db_xref="GO:0016491"
FT                   /db_xref="GO:0050660"
FT                   /db_xref="GO:0055114"
FT                   /db_xref="InterPro:IPR001327"
FT                   /db_xref="InterPro:IPR013027"
FT                   /db_xref="UniParc:UPI0001831327"
FT                   /db_xref="UniProtKB/TrEMBL:B6H7Z7"
FT                   /transl_table=1
FT                   /translation="MPGLEEQPPFKVLIVGGSYSGLAATLNLIDLCHGRKCRFNLDENE
FT                   KGPGHTIPVQVTIVDERDGYYHLIGLPLAMASNADASTFWKKFDDIPALQSPDINHIQG
FT                   RVDSIDCKSRIARIRQNTSNDGHKIIEEKYDFMVACSGLRREWPSAPKSLTREAYLAET
FT                   AESVQTIEEASAGVVVIGGGAVGIEIAAEIKMVQPEAKVTLIHSRQQLLSSEDLPDEFK
FT                   EKTLEMLKESGVEVVMGARVQDTVRGDESAPAKYTLKLSDGRELAADHVINAVSRFAPT
FT                   SSYLPKEACDAEGYVRITPGLQFSADVPNKKYHYAAGDIVAWSGIKRGGQAMHQAHFAV
FT                   FNIHQQMLAERYNTEPKFVELVDVAPMMALALGKTAVGYFPAMGLSSGDEIRNMFFNDD
FT                   LGYEICWKWMRLGEATE"
     atgcctggtc tcgaagaaca gccgccattc aaggttctca ttgtcggagg gtcttattcc        60
     gggttggccg caactctgaa cctcattgat ctgtgtcatg ggcggaaatg tcgattcaac       120
     ctggatgaga acgagaaggg tccggggcac acgattcctg tgcaagttac catcgtggat       180
     gagcgcgatg gctattacca tctgatcggt ctgcctctgg ctatggcttc caacgctgat       240
     gcgagcacgt tctggaaaaa gttcgacgat attcccgccc tccagtcccc tgatatcaat       300
     cacattcaag gacgagtaga ctcgattgac tgcaagtccc ggatcgcgcg catccgccaa       360
     aatacttcga atgatgggca caagattatc gaagaaaaat acgactttat ggttgcgtgc       420
     tcgggcttgc gacgcgagtg gcctagtgcg cccaagtctt tgactcggga ggcatatctt       480
     gccgaaacag cagaatctgt gcagactatt gaagaagctt cggcaggcgt ggttgttatt       540
     ggaggcggtg ctgttggtat cgagatcgcc gccgagatca agatggtcca acccgaggca       600
     aaggtgaccc tcattcactc tcggcaacag ctgctctcct ctgaggacct ccccgatgag       660
     tttaaagaaa agacccttga gatgctgaaa gagtctgggg tcgaagtggt gatgggtgca       720
     cgcgtccagg acacagttcg cggtgacgag tccgctccgg ctaagtacac gctcaagctc       780
     tcagatggca gggagctcgc tgccgatcat gtaatcaacg ccgtgtcacg gttcgcacca       840
     acatcctcat atcttcctaa ggaagcctgt gatgccgagg gatatgtccg tatcacgccc       900
     ggtcttcaat tttccgcaga tgttccgaac aagaaatatc actacgctgc tggtgatatt       960
     gtcgcctggt ctggtattaa gcgtggtggt caggcgatgc accaggcgca ttttgcagtt      1020
     ttcaacatcc accagcagat gttggcagag cggtacaata cggaacccaa gtttgtcgag      1080
     ttggttgatg tagctcccat gatggctttg gctcttggaa aaactgcggt cgggtacttc      1140
     ccagccatgg gactgtcctc gggcgacgag atccggaata tgttcttcaa tgatgaccta      1200
     ggatatgaaa tctgttggaa atggatgcgt ttgggagaag caaccgagta a               1251
//

If you have problems or comments...

PBIL Back to PBIL home page