(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_13.PE389

PENCW_13.PE389       Location/Qualifiers
FT   CDS_pept        join(886545..886935,886987..887288)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000076664" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15947717"
FT                   /orf_name="Pc16g03890"
FT                   /product="Pc16g03890 protein"
FT                   /function="N-acetyltransferase activity"
FT                   /protein_id="CAP93059.1"
FT                   /db_xref="GO:0008080"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniParc:UPI0001831328"
FT                   /db_xref="UniProtKB/TrEMBL:B6H7Z8"
FT                   /transl_table=1
FT                   /translation="MGFVVVPATLPDIRAIYDVWFAAFKGQLILDLIYPGTDINDEAFR
FT                   KVHTEGALEYWKGLSTEHTFQCIDTDTGKIAGMATWQVYWRERTAEERQKPWIGWLEGD
FT                   QRSRAEGFLEQLWEKREKWIGPKKHVYCHTVAVHPDYQGKGVGAQLMQWGMNVAEQLDL
FT                   PVYLESTVEGVPLYKKLGFQTLSEGIVFKPEITRVDKEVRAPLMAKMPTSAGNMTFEEW
FT                   AEGKTSSV"
     atgggcttcg ttgttgtccc cgccactctc cccgatatcc gggccatcta cgatgtctgg        60
     tttgcggctt tcaaaggcca attgatcctg gacctcatct acccaggaac cgatatcaac       120
     gatgaggctt tccgtaaagt ccacaccgaa ggggctcttg aatattggaa aggattgagc       180
     acggagcaca ctttccaatg cattgacacc gacaccggta aaatcgccgg catggcaaca       240
     tggcaagtct actggcgcga aaggaccgct gaagagcgcc agaagccgtg gattggatgg       300
     ctggagggtg accagcgatc gcgcgccgaa gggtttttgg aacagctctg ggaaaagagg       360
     gagaagtgga ttgggcctaa gaagcatgtt tactgccaca cagttgcagt gcatccagac       420
     taccagggta aaggtgtcgg agcacagctt atgcaatggg ggatgaacgt ggcagagcag       480
     ctggatttgc cggtgtacct tgagtcgact gtggaaggag ttcccttgta taaaaaactt       540
     ggcttccaga ctctctcgga aggaatcgtg ttcaagcccg aaattaccag ggtcgacaaa       600
     gaggttcgag caccactcat ggcgaaaatg cccacatctg ctggaaacat gacattcgag       660
     gaatgggcgg agggcaagac ttcctctgta taa                                    693
//

If you have problems or comments...

PBIL Back to PBIL home page