(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_13.PE39

PENCW_13.PE39        Location/Qualifiers
FT   CDS_pept        join(86693..86744,86795..87762)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000244351" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15945518"
FT                   /orf_name="Pc16g00390"
FT                   /product="Pc16g00390 protein"
FT                   /function="catalytic activity"
FT                   /protein_id="CAP92709.1"
FT                   /db_xref="GO:0003824"
FT                   /db_xref="InterPro:IPR006992"
FT                   /db_xref="UniParc:UPI0001831E98"
FT                   /db_xref="UniProtKB/TrEMBL:B6H6U2"
FT                   /transl_table=1
FT                   /translation="MNRIDVHHHFIPPAYVKAFNSTPGDPSGWHLPKWTPESTLSLMAS
FT                   HSTRTAILSLTAPGTSILCNFPVESANLARQINLYGSQLHQESPTRFGFFASLPHLTPE
FT                   TIPSAIEELAYALDTLQADGITLYTRYSGTGYLGHAAFAPLWEELNRRKAVVFIHPTNT
FT                   AADAQNKPEMVNPKLPQPIIDYPHETCRTAVDLITSGTISKNPDVKIILSHGGGTLPIL
FT                   ATRAANLLYDAGLTDITPEVFLEQARSFYLDLALSGNRGNLELLVGNNGFAKPGHVLYG
FT                   SDFPYAPVETINKYVGMMEEFFAQGGNKEEEVARAAAVELFPRFRIEDNKEMIPQNGL"
     atgaaccgca tcgacgtgca ccaccacttc atcccccctg cctatgtcaa ggctttcaac        60
     tcgactcctg gtgacccctc cggctggcac ctccccaaat ggacccccga gtcgaccctc       120
     tccctcatgg cctcccactc cacccgtacg gccattctat ccctaactgc accgggcacc       180
     tctatcttgt gcaatttccc agtggaatca gccaacctcg cccggcaaat caacctctat       240
     ggctcccaac ttcaccagga aagccccact cggttcggtt tcttcgccag tctcccacat       300
     ctcacacctg aaaccatccc ctcggctatc gaggaactcg cctatgctct ggacaccctc       360
     caggcggacg gtattactct ctatactcgg tatagtggaa ctggatacct cggtcatgcg       420
     gcctttgcac cgctctggga ggaactcaac cgccgtaaag cagtagtctt cattcatccg       480
     acaaacacgg ctgcggacgc acagaacaag ccggagatgg tcaatccaaa actgccacag       540
     ccaatcattg attatccaca tgagacatgt cgaacggcgg tcgatctgat cacctcaggg       600
     acgatctcga agaaccccga tgtgaagatt attctgtccc acggaggcgg tacactgcct       660
     attctcgcta ctcgcgcggc gaacctactt tatgatgcgg gactgaccga tataacccca       720
     gaggtgttcc tggagcaggc caggagcttt tatctcgacc tcgccctttc cgggaacagg       780
     gggaatttgg agttactggt gggcaacaat gggtttgcaa agccaggtca tgtgctatat       840
     ggcagtgact tcccatatgc gcccgtggag acaatcaaca agtacgttgg gatgatggag       900
     gagttctttg cccaaggagg gaataaagag gaggaggtcg cccgggctgc agcggtggag       960
     ttattcccgc gattccggat tgaggataac aaggagatga ttcctcagaa tgggctatag      1020
//

If you have problems or comments...

PBIL Back to PBIL home page