(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_13.PE390

PENCW_13.PE390       Location/Qualifiers
FT   CDS_pept        join(888312..889145,889206..889889)
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000175484" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19824348"
FT                   /orf_name="Pc16g03900"
FT                   /product="Pc16g03900 protein"
FT                   /function="ATP binding"
FT                   /function="unfolded protein binding"
FT                   /biological_process="protein folding"
FT                   /cellular_component="cytoplasm"
FT                   /protein_id="CAP93060.1"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0005737"
FT                   /db_xref="GO:0006457"
FT                   /db_xref="GO:0051082"
FT                   /db_xref="InterPro:IPR002194"
FT                   /db_xref="InterPro:IPR002423"
FT                   /db_xref="InterPro:IPR012718"
FT                   /db_xref="InterPro:IPR017998"
FT                   /db_xref="UniParc:UPI0001831329"
FT                   /db_xref="UniProtKB/TrEMBL:B6H7Z9"
FT                   /transl_table=1
FT                   /translation="MAMRKAAPPYPSFFKWVASVLKDEQGRPFIVVRDQGKKKRQHGTE
FT                   AVKSHIVAAKTVASIVKSSLGPRGLDKILISPDGDITVTNDGATILGQMEITNNVAKLL
FT                   VELSQSQDEEIGDGTTGVVVLAAAMLEQASDLIDKGIHPIRIADGYDQACEIAVAELDR
FT                   ISDEITFSKDDTTNLLKVAKTSLGSKIVSKSHDQFAKIAVDAVLSVADFERKDVDFELI
FT                   KVDGKVGGSLEDSLLVRGVIVDKDFSHPQMPDEVRDAKLAILTCPFEPPKPKTKHKLDI
FT                   TSVEEFKKLQDYEKEKFTEMIQQLKESGANLVICQWGFDDEANHLLLQNDLPAVRWVGG
FT                   PEIELIAIATNGRIVPRFEDLSSDKLGTAGVVREMSFGTTREKMLVIEECANTRAVTIF
FT                   VRGSNKMIIDEAKRSLHDALCVVRNLVRDNRVVYGGGAAEIACSIAVEDAAVKSPGIEQ
FT                   YAMRAFADALDAVPLALSENSGLSPIETLASIKSRQVKEKNTRLGVDCMMTGTNGIRRS
FT                   FHIQFRSWANLDSSDMREHFAIDPLIGKRQQLLLATQLCRMVLKINNVIISGDDQSEF"
     atgcgtattt cttccgcctt tgccgccctt tgcgggctcc aagctgccct tgctatggcc        60
     gagaacacca cttgaccctg gcaaaccttc aagtccagcc cttacgaacc tcccagtctc       120
     aaaatctcga aatccggccc taccagcccc ggatacctct tcttcgacca atcatgggac       180
     gcgcatcagt acagcgtgtt tattatgtcg gacaagaacg agcttgtctg gcagagcccg       240
     cgcggtgacc tgaagggttt ccgagtacag aaactggatg ggaagcttgt cctgacgtac       300
     ttcaacggcc tcggagtccc ggagcccttt ggttggggat acgggattat tcaagttttg       360
     gatgagtcct atcaaagcat ctacaatgtc tccgtgacaa atgacaacta caaggctttg       420
     ggcagcattg acagctcctc ttttgtatct tggattgaca tgcacgagaa cacaatgacg       480
     cctgatggaa caatgctggt cacaggttac aatgttaccc gggccgatct cagttctgtg       540
     ggcggcccaa aggatggctg gatcgctgac tcactctttt atgagatcga cgtcaagacc       600
     aacgagatcc ttttccgctg gagcgctctg gaccacattg atcagatccc cttggaacac       660
     gtgcagcctt tctacccgat taaagactgg ggacgcaaca gcagctatcc ctatggctac       720
     ttccacatca actccgtgga caagttccag gatggaacgt acatcatttc ctcccgttac       780
     tactgttcgc tgttcaagat tgcgaaagac ggatcggttg actggacact acagggtcaa       840
     accggcggcg acttcaatct caacggaatc aaattcagct accaacacga cgcccgcatc       900
     cacaacgagg ctgaggatgg attcatgctc agcatcttcg acaacgccaa ctccgatgtc       960
     cagaacggaa ctcaccacac tgaaggcata ctgatgaacg tcaatctagc cactcgtgag      1020
     gtctcccttg tccagactct ccacgattcg cgcgatgaga tattctcaac ttctcaagga      1080
     aacacacaac ttctgcctgg aaaccatgcc ataatgggct acggatcaaa ccctaagatc      1140
     aaggagtaca actccaacgg gacttgtgtc atgactgcgc agtttggact cgatgctgtc      1200
     gtcgcaagtt accgtgccta tcgctcaccc tgggtcggtg tccccaagac tctccccgat      1260
     gtgttctcct gcattgagca gggtcgtaac aagaccaatg tttatatgag ttggaacgga      1320
     gccactgagc atagaatgtg gaaggtcttc ggaggcgcta atgcctcaga cctgagtcca      1380
     gtcgcagctg tacggaagac aggttttgag accgtggcaa gcatcaaagg gaagcttgga      1440
     tatgttcaag tagaagctca tggcctgggg attgagaaag gagtttccaa agtcgtatcc      1500
     gtaaagggtc ggtgttag                                                    1518
//

If you have problems or comments...

PBIL Back to PBIL home page