(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_13.PE391

PENCW_13.PE391       Location/Qualifiers
FT   CDS_pept        join(complement(891934..892148),complement(891580..891867),
FT                   complement(890263..891514))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000159237" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15947718"
FT                   /orf_name="Pc16g03910"
FT                   /product="Pc16g03910 protein"
FT                   /biological_process="transmembrane transport"
FT                   /protein_id="CAP93061.1"
FT                   /db_xref="GO:0055085"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR016196"
FT                   /db_xref="UniParc:UPI00018313F7"
FT                   /db_xref="UniProtKB/TrEMBL:B6H800"
FT                   /transl_table=1
FT                   /translation="MASKETQIAQVTAADVTYPTEKETETAQPPAYAADGNSDQESLDQ
FT                   EAQAGVKGVQAAAAVWTKSHLILAYVIIWFIYFVTSIQEVVIRSLNPYVTSAFELHSLT
FT                   AATNIMANIIGGLSKIPLAKILDSWGRPQGMSLMLLIWVVGFIMMAGCNNVQTYAAAQV
FT                   FSSVGSQGVSYCLTVFISDTSSLKNRALMLSYATSPYIITTWIGGPIAQSVLGGPGWRW
FT                   GFGIFTIVVPVVVAPLCLLFFWNQHKAKKMGLLAPSRGPLTLSTIKQYCIEVDLIGIIL
FT                   LAGGMALFLLPFSLWSYQKDQWRSAMIICMIIFGGLLLIAFALYERFWAPVTFIPFNLL
FT                   MDRTVFFGGLMFVFEFFNSMVWGSYFGSMLQVVWGLDVTEASYVQAIYRVGSCLFCLLV
FT                   GVLIRWTGRFKWLAVYFSFPLMILGVGLMIKFRQPDAGIGYICMTQIFVAFAGGTTVIC
FT                   GELAMMAPSNHQHIAVILAMLNLFGSIGSAIGSTVSAAIWTSEFPKALAKYVPAEVNVA
FT                   KVYSDITAQLSYEWGSPARNAIAHAYGDAQRYMLITSVCMLVVAWGCAGMWRDIKIKDV
FT                   KQVKGRVI"
     atggcatcga aggagacgca gatcgctcag gtgacggctg ccgacgttac ctatcccact        60
     gagaaagaga cggagacagc ccagccaccg gcatatgcag ctgatggcaa ttcggaccaa       120
     gagtctcttg atcaagaggc ccaggctggt gtgaaggggg ttcaggccgc ggccgccgtg       180
     tggactaagt ctcatttgat cctggcatat gtgatcattt ggttcatcta ctttgtcacc       240
     tccatccagg aggtcgtcat ccgttctcta aacccctacg tgaccagtgc attcgagctc       300
     cactctttga cggctgccac gaatatcatg gccaatatca ttggaggctt gagtaaaatc       360
     cccctggcaa agatattgga ctcgtggggc cggcctcagg gtatgtcttt gatgttgctc       420
     atctgggttg tgggtttcat catgatggcg ggctgcaaca atgttcagac atacgcggcc       480
     gcccaggttt tttcgtccgt aggatcccaa ggtgtcagct attgtttgac agttttcatt       540
     tcggacacct cttcgttaaa gaaccgagcc ctcatgttgt cgtatgcaac ctcgccatac       600
     atcatcacca cctggatcgg aggaccaatt gctcaaagtg tcctcggagg ccctggctgg       660
     cgatggggat tcggaatctt caccatcgtt gttccggttg tggtggctcc tctgtgtctt       720
     ctgttcttct ggaatcagca taaggccaaa aagatgggct tgctcgcacc cagtcgtggt       780
     cctctcacct tatctacaat caagcagtac tgcattgagg ttgacttgat tggaatcatt       840
     cttctggcgg gcggaatggc cttgttcctt cttccattca gcctctggtc ataccaaaag       900
     gatcaatggc gctcggcgat gatcatttgc atgatcattt ttggaggcct tttgctcatc       960
     gcattcgctc tctacgagcg attctgggcc ccagtgacct tcatcccatt caatctactg      1020
     atggaccgaa ccgtcttctt cggtgggttg atgtttgtct tcgaattttt caactcgatg      1080
     gtctggggta gttacttcgg atccatgctc caggtcgtct ggggtctgga tgtcaccgag      1140
     gccagctatg tccaagccat ctacagagtg ggatcttgcc tcttttgtct gctagtcggg      1200
     gtcctgatcc gctggactgg tcgcttcaaa tggctcgccg tttacttctc cttcccgctt      1260
     atgatcctgg gcgttggact gatgatcaag ttccgccagc ctgatgcggg tattgggtat      1320
     atctgtatga ctcaaatctt cgttgccttc gctggtggaa ccaccgttat ctgcggcgag      1380
     cttgccatga tggcaccttc gaatcaccaa cacatcgctg ttatccttgc catgctgaac      1440
     ctgttcggta gtattggcag tgctattggg tcaactgtgt ctgccgctat ctggaccagt      1500
     gagttcccca aggcactggc taaatacgtg ccggcagagg tgaatgtggc aaaggtctat      1560
     tcggatatca ccgcccagct gtcgtatgag tggggaagcc cggctcggaa tgccattgct      1620
     cacgcttatg gagatgcgca gcgttatatg ctgattacca gtgtttgtat gctggtagtt      1680
     gcctggggat gtgctggtat gtggagagat atcaagatta aggatgttaa gcaggtcaag      1740
     ggacgcgtga tctaa                                                       1755
//

If you have problems or comments...

PBIL Back to PBIL home page