(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_13.PE392

PENCW_13.PE392       Location/Qualifiers
FT   CDS_pept        join(complement(893573..893635),complement(893255..893524))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19824349"
FT                   /orf_name="Pc16g03920"
FT                   /product="Pc16g03920 protein"
FT                   /EC_number="4.2.3.6"
FT                   /function="trichodiene synthase activity"
FT                   /protein_id="CAP93062.1"
FT                   /db_xref="GO:0045482"
FT                   /db_xref="InterPro:IPR008949"
FT                   /db_xref="UniParc:UPI00018313F8"
FT                   /db_xref="UniProtKB/TrEMBL:B6H801"
FT                   /transl_table=1
FT                   /translation="MVGLSPEVKAELPEIISMFFPLNDIISLYKEMDEMDKCNFVIKSA
FT                   RCKELTQVEVLRKLCGDTSDVIRTSRPPGKAHFGLSKVIEAFLPGYKTYHRHWFLTLEN
FT                   SSRLLL"
     atggttgggc ttagccctga ggttaaagca gaacttcctg aaatcatatc tatgttcttc        60
     ccactgaatg acattatatc attatacaaa gaaatggatg agatggacaa atgtaatttc       120
     gtcataaaat cggccaggtg taaagagctg actcaggtcg aggttctgag gaagctctgc       180
     ggtgacacaa gcgacgtgat tcggacttcg cgtccgcctg ggaaagctca cttcgggtta       240
     tcgaaggtta tcgaggcttt ccttccgggt tataagacgt accaccgaca ctggtttctg       300
     acgcttgaaa acagttcaag gcttctacta tga                                    333
//

If you have problems or comments...

PBIL Back to PBIL home page