(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_13.PE393

PENCW_13.PE393       Location/Qualifiers
FT   CDS_pept        join(complement(894677..894758),complement(894535..894610),
FT                   complement(894343..894479),complement(893980..894071))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18128690"
FT                   /orf_name="Pc16g03930"
FT                   /product="Putative uncharacterized protein Pc16g03930 "
FT                   /protein_id="CAP93063.1"
FT                   /db_xref="UniParc:UPI00018313F9"
FT                   /db_xref="UniProtKB/TrEMBL:B6H802"
FT                   /transl_table=1
FT                   /translation="MPWCLGDPLAGVVRVYPRRSCEGSDTRCTKEGARLSSPLVKKGSW
FT                   ELAEPECRYIRWREWDKLWGLGSANLLLLKHMLTVYEDGAWIAVMPMSHGRKEGGSKGY
FT                   NAERLMETSRCTVECEMILNSCGS"
     atgccttggt gcctcggtga cccacttgcc ggtgttgtac gtgtgtaccc gcgaaggtct        60
     tgtgaaggct ctgatacgcg atgtacgaaa gaaggggcga gactttcgag tccactcgtt       120
     aagaagggtt catgggagct ggctgagcct gagtgccgtt acattcgctg gcgagaatgg       180
     gataagctct ggggattagg ctctgcgaac ctgctactgt tgaaacacat gttgaccgtg       240
     tatgaagacg gggcgtggat tgcggtgatg cccatgtcgc atgggaggaa agaaggagga       300
     tccaagggtt ataacgcaga gagactcatg gagacgtcga ggtgtacggt ggagtgtgag       360
     atgatattga atagttgcgg aagctag                                           387
//

If you have problems or comments...

PBIL Back to PBIL home page