(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_13.PE394

PENCW_13.PE394       Location/Qualifiers
FT   CDS_pept        join(894901..895012,895077..896497)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000261850" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19824350"
FT                   /orf_name="Pc16g03940"
FT                   /product="Pc16g03940 protein"
FT                   /function="amino acid transmembrane transporter activity "
FT                   /cellular_component="integral to membrane"
FT                   /protein_id="CAP93064.1"
FT                   /db_xref="GO:0015171"
FT                   /db_xref="GO:0016021"
FT                   /db_xref="InterPro:IPR002293"
FT                   /db_xref="InterPro:IPR004762"
FT                   /db_xref="InterPro:IPR004840"
FT                   /db_xref="InterPro:IPR004841"
FT                   /db_xref="UniParc:UPI00018313FA"
FT                   /db_xref="UniProtKB/TrEMBL:B6H803"
FT                   /transl_table=1
FT                   /translation="MAGDIEESPEKHSHGTSHKLPDLQRRLKSRHLQMIAMGGAIGTGL
FT                   FIGSGSAIATAGPVGALIAFTFIGSIVYSVMIALGEVATYLPIAGAFATYATRLVDPSL
FT                   GFAMGWIYWFSWASTFALELTATGLIIQYWDDAIPMAIFIAVFWVVIIILNMFPVSCYG
FT                   EVEFWLSSIKIITVVGFMIFAICINAGVGREGYLGFRYWVHPGPFRAYLIEDSGQDALA
FT                   KFVGFWAILIKAGFSYQGTELVGIAAGETENPRRNIPSAIRKTFFRIVFFFVFTIFFVG
FT                   IVVPSDDKRLTSDDSGTNADASPFVIAAKRAGVNVLPSIINAVLLTVVLSAANSNVYSG
FT                   SRILVGLAHEGFAPRFFLKTTKHGVPYASVGFTALFGLLGFLNVSNAGATVFNWLMQIA
FT                   GLAGFITWASLNICHLAFMKALAAQGIPRDTLPYKAPWQPFFSWYGLFFNILIIITQGF
FT                   TAFIPKFSVTDFFINYLSLMLFAVLYIGHKVVFRPGFVKPKQADIDTGRFEE"
     atggccggcg acattgaaga gagtccagag aaacacagcc atggcacgtc acacaagctg        60
     ccggatttgc agcgaaggct caaaagccga catctacaga tgatcgcaat gggaggtgcc       120
     ataggcacag gtctgttcat cggtagtggg agtgccattg ctaccgcagg ccctgtcggc       180
     gccctgattg cattcacctt cattggatca atcgtgtatt cagtcatgat agccttgggt       240
     gaggtagcca cctacctacc gatcgcagga gccttcgcca catatgcgac gcgcctagtc       300
     gatcctagtc taggctttgc aatgggctgg atctactggt tttcatgggc ctcgacattt       360
     gccctggaac tgactgccac tgggctgatc attcaatatt gggacgacgc gatcccaatg       420
     gcgatattca ttgctgtgtt ctgggttgtt attataatct tgaacatgtt ccctgtcagc       480
     tgctacggtg aagtcgagtt ctggctttcg agtatcaaaa tcatcaccgt tgtcgggttt       540
     atgatcttcg ctatttgcat caatgctggc gttggcaggg aggggtacct gggattcaga       600
     tactgggtgc atccgggccc attccgcgct tatctgatcg aggattctgg acaggacgct       660
     ctggcgaaat tcgtcgggtt ttgggccatt ctgatcaaag ccgggttttc gtaccaaggt       720
     accgagctgg tcggtattgc agcgggtgaa acggaaaacc ctcgcaggaa catcccgtct       780
     gcgattcgga aaaccttctt tcggatcgtg tttttctttg tctttacgat tttcttcgtc       840
     ggcatcgtcg tgccgtctga cgataaacgt ctcacctctg atgacagcgg tacgaatgcg       900
     gatgcgtccc cgttcgtcat tgctgcgaaa cgcgctggtg tcaatgtcct acccagtatc       960
     atcaacgctg tcctgcttac tgtggtcctt tccgctgcca attcgaacgt ctatagcggg      1020
     agtcggattc tagttggttt ggctcacgag ggcttcgctc ctcggttttt cttaaagaca      1080
     accaaacacg gcgtgcccta tgcaagtgtt gggtttacag ctctttttgg cctgttgggc      1140
     ttcctgaatg tctcaaatgc cggagctacg gtctttaact ggctgatgca gattgctggc      1200
     ttggcaggtt ttattacctg ggcatctctg aatatttgcc atctcgcatt tatgaaagcc      1260
     ttggctgcac aagggattcc gcgcgacact cttccatata aggctccctg gcagcccttt      1320
     ttctcgtggt atggcttgtt cttcaacatc cttatcatca ttactcaggg tttcactgca      1380
     ttcatcccga agttcagtgt taccgacttc ttcatcaact acctcagtct catgctgttt      1440
     gcagttctat atattggtca caaggttgtt ttcaggccgg gatttgtgaa gcctaaacag      1500
     gcagacattg atacgggacg atttgaggaa tga                                   1533
//

If you have problems or comments...

PBIL Back to PBIL home page