(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_13.PE395

PENCW_13.PE395       Location/Qualifiers
FT   CDS_pept        join(complement(897258..897508),complement(897066..897189))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000207796" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18128691"
FT                   /orf_name="Pc16g03950"
FT                   /product="Pc16g03950 protein"
FT                   /protein_id="CAP93065.1"
FT                   /db_xref="UniParc:UPI00018313FB"
FT                   /db_xref="UniProtKB/TrEMBL:B6H862"
FT                   /transl_table=1
FT                   /translation="MSMSVSANTRPQAGAPASPASRRLLIFQETCNPQNVAEIVYIPVN
FT                   KLGLPICGDGPELPSILLLPLRVLRVFTDIFNQPKYKGWAVVSAGPYRDVSEEGKFYAV
FT                   LLEQTQNTVHASHETHMGTP"
     atgagcatga gcgtgagcgc aaacaccaga ccacaagccg gcgcaccggc gtcgcccgcc        60
     tcgcgccgtc tcctcatctt ccaggagacg tgcaacccgc agaacgtcgc agagattgtg       120
     tacatccccg tcaacaagct ggggttacct atttgtggtg atgggcctga gttgccttct       180
     attctgctgt tgccgttgcg ggtgctgagg gtgtttacgg atatctttaa ccagccgaag       240
     tataaggggt gggctgttgt ctcggctggt ccttaccgtg atgtctcaga agaagggaaa       300
     ttctatgctg tgctcttgga gcagacgcag aatactgtgc atgcatcgca tgagactcat       360
     atggggacac cttga                                                        375
//

If you have problems or comments...

PBIL Back to PBIL home page