(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_13.PE399

PENCW_13.PE399       Location/Qualifiers
FT   CDS_pept        join(complement(908115..908616),complement(907560..908062),
FT                   complement(907379..907490),complement(906962..907326),
FT                   complement(906523..906912),complement(906281..906470),
FT                   complement(906101..906207))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000207785" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20671667"
FT                   /orf_name="Pc16g03990"
FT                   /product="Pc16g03990 protein"
FT                   /function="sequence-specific DNA binding transcription
FT                   factor activity"
FT                   /function="zinc ion binding"
FT                   /biological_process="regulation of transcription, DNA-
FT                   dependent"
FT                   /cellular_component="nucleus"
FT                   /protein_id="CAP93069.1"
FT                   /db_xref="GO:0003700"
FT                   /db_xref="GO:0005634"
FT                   /db_xref="GO:0006355"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="InterPro:IPR001138"
FT                   /db_xref="UniParc:UPI00018313FF"
FT                   /db_xref="UniProtKB/TrEMBL:B6H866"
FT                   /transl_table=1
FT                   /translation="MGRKPNQLILEFFHRGPKLEDASNRYQHTCKACGEVFPKGRIDSL
FT                   TNHLVKKCQAIPLRDRQRVLLRLHELPDLTDGDSNKDSPSGSKGKSADGGFPNRQNFDG
FT                   LNVLAEASRQVGASDVTKRGPGYTQSVTAGGKTVIVDPALEAEGFQGHSQGPDSKAEGT
FT                   ANAEGTPQSSNAPSIPALPSHTPGEHPASMSPPLGDASMSPESTSNARQSQLSMIAASA
FT                   NEMVPQGMSIDSDSDMKMNQWNQQLSTHEQLLFDSLQEHDPSLTAATQRAASYPRPIAM
FT                   NPNTQAKGFVNEFGNSTKPMKPKVRGRFTAERRREVQDVRKKGACLRCRMLKKPCSGDT
FT                   PCTTCASVESARLWKHPCLRTRLSDEFELYNANLNSTLAYHDTNSIKNQIKFEHYSGRI
FT                   EVTHFEESNSFMTFSGLQGHRTSVSALDPQLQALGDDQFAGPSQEVYLLDADSDDIPSK
FT                   LEMYIKKNASYFYERETSPFMKPTLLLAAELNQGKKDILLERVLELWVATHILVDTELT
FT                   WKTYYNPTLPPNSLHSLSQPSDEGRLPIEEVSDPESYGLLCSQLRAAMEKRASQLSKFV
FT                   INDLERRLLQRQKCGWFDTFIVAIILLNCVDRTCWLFRSWDNENFSQRWPLDKRPPYYF
FT                   NQSDRFADILEMLLRMRHIPPKATFRPDNGILKAVDGSDEHAIRWFDMIQITPYFIEER
FT                   KNAVFDPSDSRSLDCHHSASLLEPNNAT"
     atgggtcgca aacccaacca actcatcctc gagttcttcc accggggccc caagctggaa        60
     gacgcgagta atcgctacca acatacctgc aaagcttgcg gcgaggtgtt tccaaagggt       120
     cgcattgaca gccttacgaa ccacctggtg aaaaaatgtc aggcgattcc cctacgcgac       180
     cgtcaacgcg tgttgttgcg acttcacgaa ctccccgact tgaccgacgg tgactcgaat       240
     aaagattctc cctctggaag taaaggaaag tctgccgatg gtggatttcc caaccgacag       300
     aatttcgacg gtctcaacgt gttggccgaa gcctcgcggc aagtgggcgc ctcggacgtg       360
     accaagcgtg gacctggtta cactcagtct gtgacagctg gaggcaagac cgtgattgtt       420
     gaccctgcgc tcgaagcaga gggattccag ggacattcac aagggcctga ctccaaggcc       480
     gagggtacgg cgaatgccga ggggacaccc caatcatcca acgcccctag tattcctgcc       540
     ctaccaagcc acactccagg cgaacaccct gcgtccatgt ccccgcccct cggcgatgcg       600
     tccatgtcgc ctgaatctac gtctaatgcg cgccagtcac aactgtcgat gattgcagcc       660
     tccgccaatg agatggttcc tcaaggaatg tcaattgaca gtgactctga catgaagatg       720
     aaccagtgga atcagcagct gtccacacat gagcaacttc ttttcgacag cctgcaagaa       780
     catgatccct cgttgactgc tgctactcag cgtgcggcat cttacccccg ccctattgcg       840
     atgaacccaa atacccaggc aaaaggattt gtgaacgagt tcggtaactc aaccaagccg       900
     atgaagccca aggtgcgggg ccgtttcact gcagaacgac gccgtgaagt tcaagacgtg       960
     cggaagaagg gtgcatgcct tcgttgccga atgctaaaga agccttgctc tggcgatacc      1020
     ccttgcacaa cttgcgctag cgtggagagt gctcgtctat ggaagcaccc gtgcctgcgc      1080
     acccgccttt ccgatgagtt tgagctctac aatgcgaatc tcaactctac acttgcctat      1140
     catgatacta acagcatcaa aaaccaaatc aagttcgaac actactctgg tcgcattgaa      1200
     gttactcact tcgaggagag caattctttc atgactttca gtggactgca aggtcaccgc      1260
     acttcagtgt ctgcacttga cccccagttg caagcccttg gagatgacca gttcgctgga      1320
     ccctcgcaag aagtctacct cctggacgca gactcggatg acattccaag caagttggaa      1380
     atgtacatca agaaaaacgc ctcttacttc tacgagcgag agacctcgcc tttcatgaag      1440
     cccactttgc tgcttgctgc cgaactcaac cagggaaaga aggatatcct tctggaacgt      1500
     gtgttggagc tgtgggtcgc gacccatatt ctcgtcgaca cagaactcac ctggaaaact      1560
     tactacaacc ctactttgcc tccgaattca ttgcactccc tttctcagcc atcggatgag      1620
     ggtcgtctcc ccattgagga ggtctctgac ccagaatcgt acggacttct ctgcagtcag      1680
     ttgcgcgccg ctatggagaa gcgtgcctcc cagctgagca agtttgtcat caatgatctg      1740
     gaacgtcgac tcctccagcg ccagaagtgt ggctggtttg atactttcat tgtcgctatc      1800
     atcctcctga actgcgtcga tcgcacctgc tggctgttcc gttcatggga caacgagaac      1860
     ttttctcagc gctggcccct cgacaagcgt cctccctatt acttcaacca gtctgaccgc      1920
     ttcgccgata tcctggagat gctcttgcgc atgcgccaca ttcctcccaa ggccactttc      1980
     cgtccggaca atggtatcct gaaggcagtc gacggtagcg acgagcacgc catccgctgg      2040
     tttgatatga ttcagattac cccctacttc atcgaagagc gcaagaacgc cgtcttcgac      2100
     ccatccgact ctcgctccct ggattgccac cacagtgcca gtctccttga gcctaacaat      2160
     gccacttag                                                              2169
//

If you have problems or comments...

PBIL Back to PBIL home page