(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_13.PE4

PENCW_13.PE4         Location/Qualifiers
FT   CDS_pept        join(complement(10378..10406),complement(9798..10266),
FT                   complement(9015..9624),complement(8497..8963))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18128152"
FT                   /orf_name="Pc16g00040"
FT                   /product="Pc16g00040 protein"
FT                   /function="nucleic acid binding"
FT                   /protein_id="CAP92674.1"
FT                   /db_xref="GO:0003676"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="UniParc:UPI0001831CCD"
FT                   /db_xref="UniProtKB/TrEMBL:B6H6R4"
FT                   /transl_table=1
FT                   /translation="MRKSWRAGVTAQIETVYHLLRPDAIEGRLPGRRRERVNYISPGPN
FT                   DVWHVDGHMKLEPFGIEIYAAIDGYSRYIVWPYVGVSARTAVSVQRQCLDVFAEYGFQP
FT                   RKIRSDRGTETVLLADTQYELRKLGDPSVQIRDCYLYGRSVDNQRIEGWWGLLSRATTG
FT                   LFHEYFKCLQRENLFVKDCIPEQVSLLAIYMPLIRCRVEAYTNQWNYHHIQSQPHRPHV
FT                   VKGKPIMNWKHADVPDLHCPINLDPTSEQGQLLQSLREDVQDWDPDEYLPPSTLTWCHQ
FT                   QLTEIGQQLVGIPFNPNDPNPALCGEPRAPYRAVYEALRERAFTHWNTGYNPILDVCIK
FT                   PHGAADWQGIGAAPANWQVADWQVTADWEVSRDFLSLINFSSSIDFSSSINFSSISSMA
FT                   APNSVLANAFVTALQQAGYTISAPATAPATAPATAPPPPYTATPYTAPPYTAPLYTAPP
FT                   YTAPPSTAPPSTPFSGLRGTVSSTRLAYQRQRGNQVAERDIPLTVTFYLQERPGETNCW
FT                   GGHVLIT"
     atgaggaagt cctggagagc gggagtcacg gcccaaatcg agaccgttta tcacctcctc        60
     cgtcctgatg ctatcgaggg ccggctccct ggccgacgtc gcgagagagt taattatatc       120
     tcaccagggc cgaatgatgt atggcatgtt gacgggcata tgaagcttga accgttcggt       180
     attgagatct atgctgcaat tgacggatac tctcggtata tcgtctggcc atacgttgga       240
     gtgagcgctc gcactgcagt tagtgttcaa cgccaatgtc tcgatgtctt tgcagagtat       300
     ggcttccagc ctaggaagat ccgctctgat cgaggtacgg agactgtgct tcttgctgat       360
     acacagtacg agcttcggaa actaggagat ccctcagtac agatccggga ctgctatctc       420
     tatggccgga gtgttgataa ccagcgaatt gaaggatggt ggggtcttct atcaagagca       480
     acaactggtc tcttccatga gtatttcaaa tgcctccaac gcgaaaacct ctttgtgaaa       540
     gactgtatac cggagcaagt ctctcttctc gctatctata tgccgcttat tcgatgccga       600
     gttgaagcat ataccaacca atggaattat catcatattc aaagccagcc tcaccgcccc       660
     catgttgtaa aagggaagcc aataatgaat tggaaacacg ccgatgtgcc agacctacac       720
     tgtcctatca acctagatcc cacttctgaa cagggacagc ttctccagag tttacgcgaa       780
     gatgtacagg actgggatcc cgatgaatat ctcccaccgt ctacacttac ctggtgtcac       840
     cagcagctta ctgaaattgg acaacagcta gtgggtatac catttaaccc taacgatccg       900
     aatccagctc tttgtgggga gcctcgagcg ccgtatcgag cggtgtatga agcactacgg       960
     gagcgagcat ttacgcactg gaacaccggc tataatccaa ttctcgacgt ttgtataaag      1020
     ccgcacggtg cagctgattg gcagggtata ggtgcagctc cagctaattg gcaggttgca      1080
     gattggcagg ttacagctga ttgggaggta tctcgggatt tcttatcttt aattaacttc      1140
     tcatcttcaa ttgatttctc atcttcaatt aacttctcat ccatctcaag tatggctgct      1200
     cctaatagtg tcctcgcgaa tgcatttgtc accgctctcc agcaagcagg ttatacaata      1260
     tcagcgccag cgacagcgcc agcgacagcg ccagcgacag cgcccccacc cccatacacc      1320
     gcaaccccat acaccgcacc cccatacacc gcacccctat acaccgcacc cccatacacc      1380
     gcacccccaa gcaccgcacc cccaagcact ccgttctcgg gcctccgcgg tacagttagc      1440
     agcacccgcc ttgcatacca gcgccagcga ggtaaccagg tagcggagcg agatatacca      1500
     cttaccgtga cgttttatct ccaagagaga ccaggcgaga caaattgttg gggtggtcac      1560
     gtgcttatca cgtga                                                       1575
//

If you have problems or comments...

PBIL Back to PBIL home page