(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_13.PE402

PENCW_13.PE402       Location/Qualifiers
FT   CDS_pept        join(complement(914704..915398),complement(914576..914650),
FT                   complement(914439..914526))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000169819" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20671668"
FT                   /orf_name="Pc16g04020"
FT                   /product="Pc16g04020 protein"
FT                   /biological_process="response to stress"
FT                   /cellular_component="integral to membrane"
FT                   /protein_id="CAP93072.1"
FT                   /db_xref="GO:0006950"
FT                   /db_xref="GO:0016021"
FT                   /db_xref="InterPro:IPR007568"
FT                   /db_xref="UniParc:UPI0001831400"
FT                   /db_xref="UniProtKB/TrEMBL:B6H9G8"
FT                   /transl_table=1
FT                   /translation="MSTICTEITSQCPVEATTYGYYPNLGGNIFFTIYFGLLGVCQLGL
FT                   GIYTRTWTFLAALGIGTLMEAAGYVGRILMHDNPWSTSGFRLQIFCLILAPTFIAAGIY
FT                   LTLKHIIIYIGPQYSRMNPKLFTWVFIGSDVGSIVLQAAGGGVANAAGTDQAMINTGNN
FT                   IIIAGIAFQVATMSVCGLLASDFFIASRKHLREGFQGEAATEKPQQRMWLVLVAEIGAY
FT                   TTVLIRCIYRLPEMAGGWGNKLMRNEMEFLVLDGMMIALACLVFTVVHPGLYLHTMRTG
FT                   RSRP"
     atgtcgacta tttgcacaga aattacctcc caatgccctg tcgaagcaac tacatacggc        60
     tactatccca accttggcgg caacatcttt ttcacaattt atttcggcct ccttggagtt       120
     tgtcaactag gcctcgggat atacacgcga acatggactt tcctcgcagc tcttggtatt       180
     gggacactca tggaagccgc cggatatgtg ggacgaatcc tcatgcacga caatccatgg       240
     tcaacgtctg ggtttcgact acagatcttc tgcctgattc tcgctccgac attcattgcc       300
     gctggaatat atcttaccct caagcacata ataatatata ttggaccaca atactcgcgc       360
     atgaacccga aacttttcac ctgggtattc attgggtctg atgtcggatc cattgttttg       420
     caagcagctg gcggaggagt ggccaatgca gcggggaccg accaagccat gatcaatacg       480
     ggaaataata tcatcattgc tgggattgcc ttccaggttg ccacaatgtc ggtgtgtggg       540
     ttactagcgt cggacttctt cattgcatca aggaagcatc tgcgcgaagg tttccaagga       600
     gaagccgcga ctgagaagcc acaacaaaga atgtggttgg tattggttgc agagattggg       660
     gcctatacca cagttctcat tcgttgtatt taccgtcttc ctgagatggc aggtggatgg       720
     gggaacaaat tgatgcggaa cgaaatggag ttcttagttc ttgatggaat gatgattgct       780
     ctggcctgtc tggtatttac cgtcgtccac cctggactat atctgcacac aatgagaaca       840
     ggacggagcc gtccgtaa                                                     858
//

If you have problems or comments...

PBIL Back to PBIL home page