(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_13.PE403

PENCW_13.PE403       Location/Qualifiers
FT   CDS_pept        join(915645..915679,915780..916803)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000216713" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18977576"
FT                   /orf_name="Pc16g04030"
FT                   /product="Pc16g04030 protein"
FT                   /protein_id="CAP93073.1"
FT                   /db_xref="UniParc:UPI0001831401"
FT                   /db_xref="UniProtKB/TrEMBL:B6H9G9"
FT                   /transl_table=1
FT                   /translation="MDAINARSGVSSACTARELPCVYSTPCPRRYSPTETSLKPEPKPP
FT                   AKPAFISPKYHAQHLLLMHKFSTETYKSICGDHSDIEGWQVLIPKLAFEHEFLLHGIFS
FT                   IAALHMAATNADPEQVLSYLDTALQCNELAFAPFREALAHLTPLNCDAVFAQSAIVTII
FT                   GIALPRLNAQHRGESFSMIETMMTVFELLQGASKISQISKPWRQASIFFKYDWRENTTL
FT                   DPDVANAIAQLRMLNGPIESTDSAQNSINQEAIDSLEDSFAKFTNAPHPAPILAWLTYV
FT                   KREFVHGLRERQPFQLLILMNWAVLLNELEASFWWAKGCGKALVAELLTELKDHNEKWK
FT                   SALQWPQQMVGI"
     atggatgcaa tcaatgcaag gagcggcgtg tcaagtgcat gtacagctcg ggagctaccc        60
     tgcgtctata gcacaccctg tcctcgaaga tattccccaa ctgagacctc tttgaagcca       120
     gagccgaaac caccggccaa gccagctttc atatcaccaa agtaccatgc ccaacatctg       180
     ctgctgatgc acaaattctc aaccgaaact tataaaagca tatgcggcga ccactctgac       240
     atagagggct ggcaggtcct catccccaag cttgctttcg aacatgaatt tctcttacat       300
     ggcatctttt ccatcgccgc gctccacatg gcagccacca acgcagaccc agaacaagtt       360
     ctatcttacc tagacaccgc actgcagtgt aatgaacttg catttgctcc cttcagagag       420
     gctttggccc acctcacccc tcttaactgc gacgccgtat ttgcccagtc agcgatcgtt       480
     actatcattg gcatagcact gcctcggctg aacgctcagc atcgcggtga atccttcagc       540
     atgatcgaaa caatgatgac tgtttttgaa ctgctgcagg gggcaagtaa gatctcacaa       600
     attagcaaac catggcgaca ggcaagcatc ttcttcaaat acgactggag agagaatacc       660
     accctggatc cagacgtggc aaatgctatc gcgcaactgc gaatgctgaa tggcccgatc       720
     gaaagcacag attcagcaca aaatagcatt aaccaggaag ctatcgactc cctagaagac       780
     tcctttgcta aattcaccaa tgcgccgcat cctgcaccta tcttggcttg gctcacctac       840
     gtcaagaggg aatttgtgca tggactacgc gaacggcagc cattccagtt gttgatcctc       900
     atgaattggg cagttctgtt aaatgaatta gaagccagct tttggtgggc taagggctgc       960
     gggaaggcac tagtcgctga gttattgact gagctgaagg accacaatga gaagtggaaa      1020
     tcggcactgc aatggccgca gcaaatggtc ggaatataa                             1059
//

If you have problems or comments...

PBIL Back to PBIL home page