(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_13.PE404

PENCW_13.PE404       Location/Qualifiers
FT   CDS_pept        join(complement(921026..922497),complement(920829..920978),
FT                   complement(920071..920757),complement(918775..920032),
FT                   complement(918144..918728),complement(917785..918093),
FT                   complement(917317..917736),complement(916908..917159))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20671669"
FT                   /orf_name="Pc16g04040"
FT                   /product="Pc16g04040 protein"
FT                   /function="DNA binding"
FT                   /function="sequence-specific DNA binding transcription
FT                   factor activity"
FT                   /function="zinc ion binding"
FT                   /biological_process="regulation of transcription, DNA-
FT                   dependent"
FT                   /cellular_component="nucleus"
FT                   /protein_id="CAP93074.1"
FT                   /db_xref="GO:0003677"
FT                   /db_xref="GO:0003700"
FT                   /db_xref="GO:0005634"
FT                   /db_xref="GO:0006355"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="InterPro:IPR001138"
FT                   /db_xref="InterPro:IPR007219"
FT                   /db_xref="UniParc:UPI0001831402"
FT                   /db_xref="UniProtKB/TrEMBL:B6H9H0"
FT                   /transl_table=1
FT                   /translation="MSSGPEKPKKVPRKHVTTACVPCRESKIRCDGATPHCQNCQRKGK
FT                   ECKYQHGDDKRNPHRQSHYLIFPRLKANVTRVSLRASTELFSARIDQLCHFIKEQGLEP
FT                   PPMNPEDEAGMNRVLDTLQIPRGFPQVSAVADEKRPPVEATASGVSSKSPSQDPPTVNP
FT                   KGQSPSTNPVACGASPAQDTASSGKVPSPEGWNPFGMVPGASDNQNFVHWGFTLPTAES
FT                   LDTIYANLNGGPRAPTMPRIPVNTEMNPDSYQLGMDMAQQPGSLLGQLPHEGDNDSDSG
FT                   EEDEAENDVIEQLSHRIGTLKIAGDGHLRFYGATSNLNLVDVSATQQRQRPDARTVRHD
FT                   GQDILNHLRVGQPVDQALEDHLVELYFTWQNPSTYIVDKEMYMTARTKWRNELDDTPFY
FT                   SEVLTNAMCAIGSAFEARYHPTFITFPKSLAEFFADRAKALLEIELDSPCVATVQALVI
FT                   MSCHEGASNRDARGWLYSGMSMRLAFDLGLHLDMTAYVNKGEITQLEADVRRATFWGSY
FT                   VADHFWGFYLGRPFRMNAGDIGVPKPGSALSPEKEENWHPYGHQAAHALSQNGLRNPME
FT                   LICRQFVVLWEMITPVGHILYGCSDISRHDLQRICYQVTEDLFAWKANLPSILQIDLND
FT                   DTSPILPHLMMLHMQYHQIIIFFHRPWLSKSYIQPRSPRQGPGYHHARRMCVESATAIA
FT                   RLLQLFEKHYTFRRMNNQVVAIIFSAALMLLFVTVSSSPMSPGKQGDSPTYPRSTEMVA
FT                   YLNLCFRALDELGQSFDNAKRTRDYLVTLQRRWQANMRRSGSATKRQNSSANLAALGSQ
FT                   KPSTQNTHASNAHGIDGWRKKSRLSVSGAPPNMQSTAPATTNHYSRLSQHTMPPQHQYH
FT                   QQSSYQQQAPFPVPRPDSQLGDLDWIPNSDMRLMSETQNGNALNDMGQIPSPPFPEDPS
FT                   MLSDIADIDAWWAPDNYTRTSMPP"
     atgtcgacaa gagtgctgtc gacggatgac aggaccgtcc gcggcaatca attcgcagcc        60
     tactgtgcag atcaccccaa ttttcgaatt tcacctgaaa tagcaagttt tctttcccaa       120
     tttgaagttc gtcggcctga ggcgacaaca caacgcagga ctagatcgac ggggtcaacg       180
     caacagctct atcctccaga gtgggtggtg gatgtctcac tagtacgcaa agagcttaag       240
     cagttctacg acacttacaa atcatccgaa ctcaaagcca agaaggggag cgacgcggct       300
     atagatgaat ctcttccttg gagcttcgac gaagacaaca acgtttacga tagatcagtg       360
     aaagtcatca atttgaacgc tgcaaccgac gagtccgcac agcctgaaaa aatgacacct       420
     ggaaataact gtgacactga taccgaggat gaagttgacc cggatgatca aatgatcgcc       480
     gaaggacgtg taaaggacga ggctctactt acgcaaaatg ggtttgatcc tatcttcata       540
     gaaggaaaat acccgggaga aatccccgcc gcaatcgccg agtatctgcc agaagaccag       600
     agcaaaccat cctggcagat ggttgggtcc aaccggagca ttttctggat tttcgggtac       660
     aatgatgtcg tcgatgttat cgacgatccc gcctgccttc tcgacgacga aatagtcggc       720
     gtgcccaacg gagttcaccc agtgtctttc ctgtttgctc gctatgccag cgaggataag       780
     gtaccccggc cccttcttca aaagtacttt gacagctggg cccctgctcc taccacggct       840
     ttcgtcatgc cggtcttcga cataccgcct ctggcctccg atgaaccaac taaccaccaa       900
     atccgcgacc tataccctct tggccgaacc cgccactttc caagtcacct tctatgctta       960
     cgtgtgaagt ccaataaaag gccggagaag actcgtgata tggttcagga aaagttgcgt      1020
     gacgtctttg attttgaaaa cgatgatctt tggtttcgag gggtgaacct gaagtcgctg      1080
     atgctgtcga tgtcattctt tgttcccgtc atatcgactt cacattctga caacgagttc      1140
     ggcccgggga tttacgccac caatgacttc ggcgaaggat ccaaatatgc ccagccgcaa      1200
     ggagctgtca tggtcttcaa aaatcctgat ttcagagacc ttttcgtgtg ggaacctgca      1260
     aaggatgaat ggaaccgtct gacggcgacg tggcttgata tccaaaaagg gaatctgaaa      1320
     gtatctgact cccacaatga tgccgatgtc atcaaagggc cgatgtcgtc ggaccaacat      1380
     gaagcccgca agcatggccg ttatccatcg cagggcgaaa tcacccaaat tacttgcgtg      1440
     aactatgata gctgcagggc cctcgctaag tctcaatcaa ggcaatgcga gatgtgggat      1500
     acagttttgg tcccagtttc taacaacaac tgcaaatcga gtctactgct ggtcggcggt      1560
     cgaaccgagc cactctttgt tgcaaccaca atccaaaaca ccgcagtctg tgtatccaat      1620
     gtctactaca gagcaatacg atcatctttg ccaccaccag ccttattccg taacacaatg      1680
     tatcccgtga gcattgattc ttgcttccag gcgggcgcat cgtctctctg gtctggccac      1740
     cgaagttccg tcgatagctt gatgctgccg gctatgatag acggcctgac cgtgatggcg      1800
     caaacatctt cgccagagac aggattagct gttgcagatg cagagtttac cggtattgga      1860
     agggatgatg atccccgccg gtctaagacc aacgtcaagg tatatgaccc agtcaatagg      1920
     aacttgctct tccgactttc tggccttcac taccattccc ttgacgctac cgtggagagc      1980
     catgcggcgc acacgtacac atgtttgaaa tggcaacctg acgtttcttt cctttccaat      2040
     aatcaacttt ctaccttgct tgaggcatca gagcctggaa gcagcactgc ccaggctgtt      2100
     gcgaagattg gacaggttat caaccttgtt gcccacaaga atcctcgatt gcgggtcttg      2160
     gagctcgact taattgataa agccgaaagc gtgtgggttg atcgcgttaa acccatcgct      2220
     tctgatattg ccactgagct tgagtaccat ctctcggtgc catcgcaaac tccgctatct      2280
     ccgcacggtc gaaacatgga agctcgaatt ggcatggagg acaaagacac ctatgagatc      2340
     attattctaa aggcgtctct ttatcacccg ccctcggctc ccgatatcga aaaggcccga      2400
     gatcatcttt ccgatagagg cttcctttgc gtcttgtacg acaccagtgc atttgcagga      2460
     aacttattca cacttggcgg attggaaagc atttcgacca cggaatctcc gaagtatgct      2520
     ggcgagctcc aactcgccta ctttggatct gccgtagcaa aagaaactcc agcatccagg      2580
     gctccactcc atgtgacgca cttcaagtcc ttgaatgaac ttaagtcgaa agcccttact      2640
     tatctcatgg agaatgggtg ggaggtcatt gagcattcct tgccgttcaa cgatgtccct      2700
     gagaacggga ctgttgtggt actgggcgaa atgcactctc cagtcatgtc tcatctgagc      2760
     gacgaacaat tcgaatcttt cagaaaactc attgaactcg aatgtcgaat tctctgggtc      2820
     acacgaggtg cgcagatgca ggtgacgcac cctgagcatg ccctcttttt ggcaccgcgc      2880
     ggtcgctata tggagaggac ccgacctctt ctaatcatgg tcttggacgt tgaaaatgca      2940
     gatgggacag ccagtctagg cgctcttcat tcggtattga aacgtcttgt ttctgcggag      3000
     acgttggaag atgaagatca cgaatttacc gagagagggg gaatggttta tatcagccga      3060
     attgttccag acaaggcggt taaccaggcc gagaaggaca gcgctttggg ccctgaaagt      3120
     caagatcaat cattgcatgg ccaccagtcc accgtgagat tgattagcac gcacactggc      3180
     accattggca gtctgcagta tgcagagcag cccgacgagg tatttggaaa ccgtgacgtg      3240
     gagattgagg tgcatgcagc ggccctcaac ttcaaggact tggcgcacgc cttgggcttc      3300
     attgcatcca acgagcgtcg tttgggctta gaatgtaccg gaatcgtcac tcgacgaggc      3360
     aatgatgcga ggtctgtttc tgttggagat cgtgtactgc tcatccggaa ggacggaggt      3420
     ggatttggca atcgagtcat cagtacagtg gagggtgtcc agcggattcc ggattggatg      3480
     tcatttgagg atgcctctac cctcggagtt tgcttcatga caactatata tagtctcatc      3540
     gatctggcca acacacaacc aggacagact gttttgatcc atgccggtgc aggaggtgtc      3600
     ggattggcgg ctatccaaat ctgtcgctac ctgcaagccg agatatacgt gaccgttggt      3660
     tcagaggaga agcgccgctt cctcagaacg gaatacggta tcccagaaga ccgcatgttc      3720
     tcctcggggt cgatatcatt tgctacggat ctcatgcggg ccaccaatgg ccgcggcgct      3780
     gatgtgatcc tgaactcgtt aacgggtgat atgctgcacg agtcctggcg ctgcctggcg      3840
     cccaatggaa acttcattga gattggcaag aaggatctcc ttgatcggaa tagcatctcg      3900
     ttggcaccat tcagccacaa tgcttcatac cggtcattcg acctgtcact caaggcggtc      3960
     tccttgccca cattcgaccg cttgttgaag cagattttcg cctttgtcaa cgatggtatt      4020
     accaagcccc ttcccatctg taagacattc tcctttggcg atattgcaga tgccttccgc      4080
     tacatgcgag atggaaagca tattggcaag atcgtcgtgt cggatgagaa ccgcgatgat      4140
     gttcgagtac ctatcattcc cgccattccc gtcctgaagc tgagagatga cgtttcatac      4200
     cttattgccg gcgggttcaa gggcctgtgt ggaagtctcg ccctctacct atcccgcgtc      4260
     ggggccaaga atatcgcggt catgtcccgt agtggatacg atgatcctgc ttctcaaagt      4320
     atcatctacc atctcaaggc aatgagaaca cacgtagacc tgattcgagg cgacatcacc      4380
     gatatcgagg acgtgcgacg agccttcgcc tctaccaaga agccggtcgg cggaattatc      4440
     caaggtgcga tggttttgcg agacaaaatg ttctccagga tgacgccgga tgagttccgg      4500
     atgcccatcg atcccaaggt agtcggaacc tggaacctgc acaacctggc catagagcac      4560
     aacctcaaac tggacttctt cactctcctg tccagtgtga gtggtgtcgt tggtcaaagg      4620
     gcccaagcca actacagtgc tggtaacgtc ttccaggact cgtttgcagt ctaccgacat      4680
     tcccttggtc tcccagcatg ctctgtgaat ttgggagtga ttgaggatgt aggatacttc      4740
     acagaccgcg acaatctcag tcgtagattg gaatcgcagg gctggacacc cataaatgaa      4800
     gctctcttgc acaaaatcct acgcttttcg attctccaac agacaggatc gccgatcaac      4860
     cccgataccg tctcattacg gcgtggacca cccggccttc taacatcagc cgtggaggtt      4920
     gtagatgcag ttttgatgcg cagtcttggt ttgaagaccc cgttggaagt aagccggcca      4980
     ttagccagct acggaatcga ttccctggtc gcagttgaat tgcgaaattg gacccggtcg      5040
     gaacttggta ttgagaccag cgcgttggat atcgtggggg ccaagacctt ggtgtcgctt      5100
     tgcgagctga ttctcaagag attgctagca tag                                   5133
//

If you have problems or comments...

PBIL Back to PBIL home page