(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_13.PE405

PENCW_13.PE405       Location/Qualifiers
FT   CDS_pept        922724..923455
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000217123" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15947722"
FT                   /orf_name="Pc16g04050"
FT                   /product="Pc16g04050 protein"
FT                   /protein_id="CAP93075.1"
FT                   /db_xref="InterPro:IPR008391"
FT                   /db_xref="UniParc:UPI0001831403"
FT                   /db_xref="UniProtKB/TrEMBL:B6H9H1"
FT                   /transl_table=1
FT                   /translation="MYDPRTTGLSDGEPRNNIDPFTQTDDYSDALSFLAVHPMVDQARM
FT                   GIWGMSLSGAVALACAAVDPRARFVVAVCPASEYSFAQAKIPSVLGKIAKDRESQLKGN
FT                   VPFYLPMLNRAGENPAGFNLGVDKDAALRILSAQDEKNPTRQALAANHVNRTTIQSYRK
FT                   LLMWSPAPIYRHLAVPVMFVVPELDQLISAARQQETFENLPGTTNQLHVEHGVGHMDVL
FT                   EGEQLPDLMKRKLLFIQGVVG"
     atgtatgatc cacgaaccac tggacttagc gatggcgagc cgcgcaacaa tatcgacccc        60
     ttcacgcaga ccgacgacta ctcggatgcg ctgagctttc tggcagttca tcccatggtg       120
     gatcaggccc gcatggggat ttggggcatg tctctttctg gggccgtggc actagcttgt       180
     gcagcagttg acccacgcgc ccgcttcgtc gtcgccgtct gtccagcttc ggagtattct       240
     tttgcgcagg cgaagatacc cagcgtactt ggcaaaattg cgaaggatcg ggagtcccag       300
     ctaaagggaa acgttccatt ctatctcccg atgctcaacc gagcgggcga gaatccagct       360
     gggttcaatt taggcgtcga caaggacgcc gctctgcgca tcctcagcgc acaggatgaa       420
     aagaacccca cacgccaagc attggctgcc aaccatgtca atcgtacgac catacagtct       480
     taccggaagc tcctaatgtg gagtccagct ccgatctata ggcatctggc tgtgccggtg       540
     atgtttgtgg tgccggagtt ggatcagctc atctctgctg caagacaaca ggagacgttc       600
     gagaatctcc cgggaaccac gaaccaactc cacgtggaac acggagtagg tcacatggat       660
     gttctcgagg gagagcagtt gccggatttg atgaagcgga agttgctgtt catccagggg       720
     gttgtaggtt aa                                                           732
//

If you have problems or comments...

PBIL Back to PBIL home page